Property Summary

NCBI Gene PubMed Count 126
PubMed Score 420.19
PubTator Score 1418.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.100 2.5e-10
psoriasis -1.100 2.7e-06

Protein-protein Interaction (1)

Gene RIF (131)

PMID Text
26334798 The frequency of -13910*T was significantly higher among the Mennonites when compared to the Euro-Brazilian cohort. Accordingly, Mennonites had a higher prevalence of the lactase persistence genotype
26054462 Diversity of lactase persistence in African milk drinkers.
25853887 Populations from two medieval sites in Central Poland, Stary Brzesc Kujawski-4 (SBK-4) and Gruczno, represented high level of lactase persistence (LP) as followed by the LCT-13910*T allele's presence (0.86 and 0.82, respectively).
25651731 Report reliabile of the single nucleotide polymorphism of lactase persistence LPH(-13910) C/T from saliva derived DNA.
25625576 In conclusion, our data indicate that identification of a -13910C/C genotype is likely to predict the presence of lactase nonpersistence, in keeping with prior published studies.
24704072 Evidence of selection around the LCT gene among Khoe-speaking groups, and the substantial frequency of the 14010C variant among the Nama is best explained by adaptation to digesting milk.
24465990 Evolutionary history of the European lactase persistence trait and its global cultural implications.
24448642 Genotypes of neolithic human remains indicate that natural selection models satisfy the observed increase in allele frequency in lactase persistence.
23993196 The LCT enhancer sequence in a large lactose-tolerance-tested Ethiopian cohort of more than 350 individuals, was examined.
23985982 The findings of this study suggest that at least the ApaI and BsmI polymorphisms of the VDR gene and T-13910C of the LCT gene are associated with the risk of postmenopausal osteoporosis in our sample of the Belarusian women.
23913618 Show new sequence data from the lactase gene for two Bedouin tribal populations, the Ajman and Mutran. Study the frequency of Lactase persistence associated alleles and discuss impact of nomadic-pastoralism on the associated genetic variation.
23647908 The lactase persistence genotype was shown to be associated with a higher BMI.
23415628 Lactase deficiency prevalence is high among different ethnic groups in Israel and varies between ethnicities. Both SNPs (C/T-13910 and G/A-22018) showed significant correlation in Israeli Jews of various origins.
23327608 An overall frequency of 0.349 for the lactase persistence (LP) - 13910*T allele was estimated in the general population, with a noticeable decrease in the South (0.269) compared with North (0.383) and Centre (0.393). Among the symptomatic group, the frequency of the - 13910*T allele (0.363) was not significantly different from the general population.
23256641 The researchers found evidence of the highest frequency of LCT-13915(*)G variant allele associated with lactose persistence in the southern Arabian Peninsula.
23252911 580 Portuguese children (age 6-12)were genotyped for the lactase persistance-13910C>T polymorphism using TaqMan probes by real-time PCR for a link with abdominal obesity, indicating the polymorphism may predispose to abdominal obesity, not confirmed
23211657 Differences in the prevalence of primary lactase deficiency were not found between celiac disease patients and controls... hereditary lactase deficiency is frequent in Italian celiac disease children as in control population.
23030683 The two SNPs were present in a strong linkage disequilibrium. lactase persistence prevalence varied in these Indian regional groups.
23029545 Single nucleotide polymorphism variants of the lactase gene in lactase persistence in the Brazilian population.
22989008 The study showed that though frequency of C/T-13910 and G/A-22018 lactase polymorphisms was comparable among irritable bowel syndrome (IBS) and controls; these were more common among patients with diarrhea-predominant IBS (D-IBS).
22965418 The findings show that while variation in the lactase gene is associated with milk intake in men, the lactase polymorphism does not have a large effect on prostate cancer risk.
22948027 Stronger signal of recent selection around the LCT gene for lactase persistence in Maasai than in Europeans.
22937140 The T-13910 of the allele LCT-13910 C>T polymorphism is positively associated with BMI. lactase persistence increases significantly the risk to develop obesity in the studied population.
22278929 no significant difference in single nucleotide polymorphism between adolescent idiopathic scoliosis cases and controls
21836184 We confirm that the 13910 C>T mutation seen in DNA samples from across the Indian subcontinent, is identical by descent to the European allele and is associated with the same>1 Mb extended haplotype in both European and Indian populations.
21763294 C/T -13910 cis-acting regulatory variant located approximately 14 kb upstream of lactase gene (LCT) completely correlates with lactase phenotype in Indian children
21686221 Report lactase persistence SNPs in African populations regulate promoter activity in Caco-2 cells.
21365615 The aim of this study was to determine the prevalence of lactase persistent and non-persistent genotypes in current Hungarian-speaking populations and in ancient Carpathian basin human bone samples.
21340236 The LCT-22018G>A allele is a better predictor of lactase persistence in Japanese-Brazilians than the LCT-13910C>T allele.
21327791 The -14010*C variant associated with lactase persistence is located between an Oct-1 and HNF1alpha binding site and increases lactase promoter activity.
21193851 despite not finding marked differences in dairy product consumption, this polymorphism [-13910C>T (rs4988235) upstream from the lactase (LCT) gene] was strongly associated with BMI and obesity and modulated by lactose intake...
21136048 the lactase gene C/T(-13910) polymorphism was associated with trabecular density at the distal radius and tibia in men.
21125297 Lactase gene expression showed a regional distinction between regions 1 and 4 of the small intestine but not between regions 1 and 3.
20960210 the -13915*G SNP region (associated with lactase persistence) of the lactase gene interacts with the Oct-1 transcription factor in in vitro binding reactions.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20616560 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
20585563 Observational study of gene-disease association. (HuGE Navigator)
20509822 the -13914G > A variant is the third variant of lactase persistence and seems to correlate with lactase enzyme activity
20509822 Observational study of gene-disease association. (HuGE Navigator)
20430969 Observational study of gene-disease association. (HuGE Navigator)
20390408 Observational study of gene-disease association. (HuGE Navigator)
20362522 In the Italian population the LCT-13910C>T polymorphism is not associated to the risk for colorectal cancer or polyps.
20362522 Observational study of gene-disease association. (HuGE Navigator)
20225268 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20190720 Observational study of genotype prevalence. (HuGE Navigator)
20015952 Lactase persistence (LP) in 31 720 individuals from eight European population-based studies and one family study by genotyping or imputing the European LP variant, was analyzed.
20015952 Meta-analysis of gene-disease association. (HuGE Navigator)
19955176 Data show that the regulation of the trafficking kinetics and activity of domain III and entire LPH including elevation of the enzymatic activities require the correct dimerization of LPH in the ER.
19947896 Observational study of genotype prevalence. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19889824 Observational study of genotype prevalence. (HuGE Navigator)
19844753 Observational study of gene-disease association. (HuGE Navigator)
19799794 The lactase persistence allele, LCT -13910T, was found in about 43% of both White and Brown and 20% of the Black Brazilians, but was absent among all Japanese Brazilians studied.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19422935 Observational study of gene-disease association. (HuGE Navigator)
19370782 The lactase-persistent/non-persistent genotype did not affect the consumption of milk products in a Russian population which could be explained by low consumption of milk products among the entire study population.
19370782 Observational study of genotype prevalence. (HuGE Navigator)
19299182 Observational study of gene-disease association. (HuGE Navigator)
19174780 Observational study of gene-disease association. (HuGE Navigator)
19168163 Young males with the lactase CC(-13910) genotype may be more susceptible to bone loss.
19168163 Observational study of gene-disease association. (HuGE Navigator)
19161632 reports novel mutations in lactase gene in congenital lactase deficiency patients with different ethnic origins
19156157 Observational study of genetic testing. (HuGE Navigator)
19138442 the C/C- 13910 genotype was associated with a lower consumption of milk since childhood, predisposing females in particular to inadequate Ca intake.
19039706 single nucleotide variant (C/T13910) of LCT gene was not correlated with bone mineral density
19034520 Lactase molecular and population genetics and the role of selection in determining present day distributions of the lactase persistence phenotype. Review.
19010095 Observational study of genetic testing. (HuGE Navigator)
18980667 LCT 13910 C/T and CaSR A986S polymorphisms may have an impact on the progression and/or incidence of ColoRectal Cancer.
18980667 Observational study of gene-disease association. (HuGE Navigator)
18974842 Observational study of gene-disease association. (HuGE Navigator)
18940163 Observational study of gene-disease association. (HuGE Navigator)
18704543 LCT 13910 C/T polymorphism is associated with decreased serum calcium level and lower bone mineral density in postmenopausal women.
18605960 Observational study of genetic testing. (HuGE Navigator)
18568133 In carriers of the CC-genotype, BTH and genotyping correlate perfectly, and the genetic test provides an unambiguous result. In BTH-positive individuals with a negative genetic test there is good reason to suspect secondary causes of lactase deficiency.
18568133 Observational study of genetic testing. (HuGE Navigator)
18544679 Observational study of gene-disease association. (HuGE Navigator)
18468259 The environmental and life-style conditions of the Kola Sami could have influenced the population-specific frequencies of the AGXTProIILeu allele, and certain alleles of APOE and LCT genes
18468259 Observational study of genotype prevalence. (HuGE Navigator)
18454942 Synergistic effect of GALT and galactose-1-phosphate uridylyltransferase mutations on cataract formation.
18454942 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18396155 Observational study of genetic testing. (HuGE Navigator)
18275674 Observational study of genetic testing. (HuGE Navigator)
18237552 A single nucleotide polymorphism, C/T(-13910), upstream of the lactase gene is validated for use in diagnosis of adult-type lactose intolerance.
18194137 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18179885 Study confirmed the absence of the European T(-13910) and established two new mutations found as a compound allele: T/G(-13915) within the -13910 enhancer region and a synonymous SNP in the exon 17 of the MCM6 gene T/C(-3712), -3712 bp from the LCT gene.
18080747 Observational study of gene-disease association. (HuGE Navigator)
18042517 The -13910T allelic frequency in the lactase (LCT) gene cannot serve as a predictor of the lactase persistence in these populations and this suggests the existence of other possible mechanisms of lactose tolerance in Chinese populations
18030226 Observational study of genetic testing. (HuGE Navigator)
18030226 The C/C-13910 genotype was found in 90% of Sardinian patients; the frequency of the positive lactose breath hydrogen test increased with age and reached a prevalence of 85% at 9 years.
17934640 a significant agreement between the occurrence of mutations G/A-22018 and C/T-13910 and lactose absorption in Brazilian subjects
17911653 T/G 13915 variant upstream of the lactase gene (LCT) is the founder allele of lactase persistence in an urban Saudi population
17706627 Observational study of gene-disease association. (HuGE Navigator)
17701907 These data show that the T(-13910) variant is found on two different, highly divergent haplotype backgrounds in the global populations.
17651714 Observational study of genetic testing. (HuGE Navigator)
17574225 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
17507622 The C/T-13910 single nucleotide polymorphism of lactase persistence did not associate with increased risk for prostate carcinoma in the Finnish or Swedish populations.
17478481 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
17478481 Genotyping of the LCT polymorphism by means of a new rapid HPLC assay was done in healthy subjects and colorectal cancer patients.
17451204 Gastrointestinal symptoms are more common among adults with the C/C(-13910) genotype of adult-type hypolactasia than in those with genotypes of lactase persistence.
17327935 Observational study of gene-disease association. (HuGE Navigator)
17327935 The overall prevalence of AtH in children (14%) was higher than previously thought. Among Caucasians, higher figures were seen in children than in the elderly (9% versus 6.8%).
17311063 Observational study of genetic testing. (HuGE Navigator)
17159977 Three SNPs (G/C-14010, T/G-13915 and C/G-13907) are associated with lactase persistence in African groups.
17143950 Milk consumption of lactose intolerant subjects is consistent with previously reported figures of adult-type hypolactasia in Estonia.
17120047 Observational study of gene-disease association. (HuGE Navigator)
17120047 cohort study of lactose digester and non-digester Sudanese volunteers shows there is no association of -13910*T or the A haplotype with lactase persistence
17015546 lactase-phlorizin hydrolase C/C-13910 genotype was not associated with mean growth speed or final mean body height; however, it contributed significantly to milk product consumption and dietary calcium intake from childhood into young adulthood
16876487 Observational study of genetic testing. (HuGE Navigator)
16400612 The molecular background of congenital lactase deficiency via characterization of five distinct mutations in the coding region of the lactase (LCT) gene was reported.
16391332 Observational study of genotype prevalence, gene-disease association, and genetic testing. (HuGE Navigator)
16301215 the binding of Oct-1 to the T-13,910 lactase variant directs increased lactase promoter activity and this might provide an explanation for the lactase persistence phenotype in the human population
16109658 Observational study of gene-disease association. (HuGE Navigator)
16024930 Observational study of genetic testing. (HuGE Navigator)
15831909 Observational study of gene-disease association. (HuGE Navigator)
15716664 Observational study of genetic testing. (HuGE Navigator)
15667380 Observational study of gene-disease association. (HuGE Navigator)
15479673 Observational study of genetic testing. (HuGE Navigator)
15365657 The adjustments for age, height, weight, smoking, alcohol consumption, and physical exercise in the multiple regression analysis did not reveal any big relationships between the lactase genotypes and BMDs at lumbar, femoral neck or total hip sites.
15178553 GATA-4 is a key regulator of LPH gene expression that may function through an evolutionarily conserved mechanism involving cooperativity with an HNF-1alpha and/or a GATA-specific pathway independent of HNF-1alpha.
15107297 Stable overexpression of pancreatic duodenal homeobox-1 results in repression of the endogenous human lactase-phlorizin hydrolase gene in differentiated Caco-2 cells
15106124 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15054412 Observational study of gene-disease association. (HuGE Navigator)
14753735 Observational study of gene-disease association. (HuGE Navigator)
12915462 A lactase persistent variant enhances lactase promoter activity in vitro.
12795467 Observational study of gene-disease association. (HuGE Navigator)
12692047 Observational study of gene-disease association. (HuGE Navigator)
12459179 Results suggest that repression of lactase-phlorizin hydrolase (LPH) gene expression is released in cells that synthesize Cdx-2, such as those in the intestinal epithelium.
12011060 demonstrate that GATA-5 and HNF-1alpha physically associate both in vivo and in vitro and that this interaction is necessary for cooperative activation of the lactase-phlorizin hydrolase promoter
11788828 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11751874 These data clearly demonstrate that the proregion of pro-LPH is an intramolecular chaperone that is critically essential in facilitating the folding of the intermediate form LPH beta(initial) in the context of the pro-LPH polypeptide.

AA Sequence

MELSWHVVFIALLSFSCWGSDWESDRNFISTAGPLTNDLLHNLSGLLGDQSSNFVAGDKDMYVCHQPLPT      1 - 70
FLPEYFSSLHASQITHYKVFLSWAQLLPAGSTQNPDEKTVQCYRRLLKALKTARLQPMVILHHQTLPAST     71 - 140
LRRTEAFADLFADYATFAFHSFGDLVGIWFTFSDLEEVIKELPHQESRASQLQTLSDAHRKAYEIYHESY    141 - 210
AFQGGKLSVVLRAEDIPELLLEPPISALAQDTVDFLSLDLSYECQNEASLRQKLSKLQTIEPKVKVFIFN    211 - 280
LKLPDCPSTMKNPASLLFSLFEAINKDQVLTIGFDINEFLSCSSSSKKSMSCSLTGSLALQPDQQQDHET    281 - 350
TDSSPASAYQRIWEAFANQSRAERDAFLQDTFPEGFLWGASTGAFNVEGGWAEGGRGVSIWDPRRPLNTT    351 - 420
EGQATLEVASDSYHKVASDVALLCGLRAQVYKFSISWSRIFPMGHGSSPSLPGVAYYNKLIDRLQDAGIE    421 - 490
PMATLFHWDLPQALQDHGGWQNESVVDAFLDYAAFCFSTFGDRVKLWVTFHEPWVMSYAGYGTGQHPPGI    491 - 560
SDPGVASFKVAHLVLKAHARTWHHYNSHHRPQQQGHVGIVLNSDWAEPLSPERPEDLRASERFLHFMLGW    561 - 630
FAHPVFVDGDYPATLRTQIQQMNRQCSHPVAQLPEFTEAEKQLLKGSADFLGLSHYTSRLISNAPQNTCI    631 - 700
PSYDTIGGFSQHVNHVWPQTSSSWIRVVPWGIRRLLQFVSLEYTRGKVPIYLAGNGMPIGESENLFDDSL    701 - 770
RVDYFNQYINEVLKAIKEDSVDVRSYIARSLIDGFEGPSGYSQRFGLHHVNFSDSSKSRTPRKSAYFFTS    771 - 840
IIEKNGFLTKGAKRLLPPNTVNLPSKVRAFTFPSEVPSKAKVVWEKFSSQPKFERDLFYHGTFRDDFLWG    841 - 910
VSSSAYQIEGAWDADGKGPSIWDNFTHTPGSNVKDNATGDIACDSYHQLDADLNMLRALKVKAYRFSISW    911 - 980
SRIFPTGRNSSINSHGVDYYNRLINGLVASNIFPMVTLFHWDLPQALQDIGGWENPALIDLFDSYADFCF    981 - 1050
QTFGDRVKFWMTFNEPMYLAWLGYGSGEFPPGVKDPGWAPYRIAHAVIKAHARVYHTYDEKYRQEQKGVI   1051 - 1120
SLSLSTHWAEPKSPGVPRDVEAADRMLQFSLGWFAHPIFRNGDYPDTMKWKVGNRSELQHLATSRLPSFT   1121 - 1190
EEEKRFIRATADVFCLNTYYSRIVQHKTPRLNPPSYEDDQEMAEEEDPSWPSTAMNRAAPWGTRRLLNWI   1191 - 1260
KEEYGDIPIYITENGVGLTNPNTEDTDRIFYHKTYINEALKAYRLDGIDLRGYVAWSLMDNFEWLNGYTV   1261 - 1330
KFGLYHVDFNNTNRPRTARASARYYTEVITNNGMPLAREDEFLYGRFPEGFIWSAASAAYQIEGAWRADG   1331 - 1400
KGLSIWDTFSHTPLRVENDAIGDVACDSYHKIAEDLVTLQNLGVSHYRFSISWSRILPDGTTRYINEAGL   1401 - 1470
NYYVRLIDTLLAASIQPQVTIYHWDLPQTLQDVGGWENETIVQRFKEYADVLFQRLGDKVKFWITLNEPF   1471 - 1540
VIAYQGYGYGTAAPGVSNRPGTAPYIVGHNLIKAHAEAWHLYNDVYRASQGGVISITISSDWAEPRDPSN   1541 - 1610
QEDVEAARRYVQFMGGWFAHPIFKNGDYNEVMKTRIRDRSLAAGLNKSRLPEFTESEKRRINGTYDFFGF   1611 - 1680
NHYTTVLAYNLNYATAISSFDADRGVASIADRSWPDSGSFWLKMTPFGFRRILNWLKEEYNDPPIYVTEN   1681 - 1750
GVSQREETDLNDTARIYYLRTYINEALKAVQDKVDLRGYTVWSAMDNFEWATGFSERFGLHFVNYSDPSL   1751 - 1820
PRIPKASAKFYASVVRCNGFPDPATGPHACLHQPDAGPTISPVRQEEVQFLGLMLGTTEAQTALYVLFSL   1821 - 1890
VLLGVCGLAFLSYKYCKRSKQGKTQRSQQELSPVSSF                                    1891 - 1927
//

Text Mined References (127)

PMID Year Title
26334798 2016 The Frequency of the LCT*-13910C>T Polymorphism Associated with Lactase Persistence Diverges among Euro-Descendant Groups from Brazil.
26054462 2015 Diversity of lactase persistence in African milk drinkers.
25853887 2015 Hunting for the LCT-13910*T allele between the Middle Neolithic and the Middle Ages suggests its absence in dairying LBK people entering the Kuyavia region in the 8th millennium BP.
25651731 2014 Reliable analysis of the single nucleotide polymorphism of lactase persistence LPH(-13910) C/T from saliva derived DNA: validation of a standardized saliva collection system.
25625576 2015 Functional significance of single nucleotide polymorphisms in the lactase gene in diverse US patients and evidence for a novel lactase persistence allele at -13909 in those of European ancestry.
24704072 2014 Lactase persistence alleles reveal partial East African ancestry of southern African Khoe pastoralists.
24465990 2014 Ancient DNA analysis reveals high frequency of European lactase persistence allele (T-13910) in medieval central europe.
24448642 2014 Direct estimates of natural selection in Iberia indicate calcium absorption was not the only driver of lactase persistence in Europe.
23993196 2013 Diversity of lactase persistence alleles in Ethiopia: signature of a soft selective sweep.
23985982 2013 Association Between Polymorphisms of VDR, COL1A1, and LCT genes and bone mineral density in Belarusian women with severe postmenopausal osteoporosis.
23913618 2013 Brief communication: Effect of nomadic subsistence practices on lactase persistence associated genetic variation in Kuwait.
23647908 2013 The lactase persistence genotype is associated with body mass index and dairy consumption in the D.E.S.I.R. study.
23415628 2013 Frequency of LCT-13910C/T and LCT-22018G/A single nucleotide polymorphisms associated with adult-type hypolactasia/lactase persistence among Israelis of different ethnic groups.
23327608 2013 Distribution of the - 13910C>T polymorphism in the general population of Portugal and in subjects with gastrointestinal complaints associated with milk consumption.
23256641 2012 Distribution of the lactase persistence-associated variant alleles -13910* T and -13915* G among the people of Oman and Yemen.
23252911 2013 The lactase persistence -13910C>T polymorphism shows indication of association with abdominal obesity among Portuguese children.
23211657 2012 Association between celiac disease and primary lactase deficiency.
23030683 2012 A study on genetic test of lactase persistence in relation to milk consumption in regional groups of India.
23029545 2012 Several different lactase persistence associated alleles and high diversity of the lactase gene in the admixed Brazilian population.
22989008 2012 Lactase persistence/non-persistence genetic variants in irritable bowel syndrome in an endemic area for lactose malabsorption.
22965418 2013 Genetic variation in the lactase gene, dairy product intake and risk for prostate cancer in the European prospective investigation into cancer and nutrition.
22948027 2013 Stronger signal of recent selection for lactase persistence in Maasai than in Europeans.
22937140 2012 Association of the European lactase persistence variant (LCT-13910 C>T polymorphism) with obesity in the Canary Islands.
22278929 2012 Single-nucleotide polymorphism in Turkish patients with adolescent idiopathic scoliosis: curve progression is not related with MATN-1, LCT C/T-13910, and VDR BsmI.
21836184 2012 Herders of Indian and European cattle share their predominant allele for lactase persistence.
21829377 2011 Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium.
21763294 2011 Effect of C/T -13910 cis-acting regulatory variant on expression and activity of lactase in Indian children and its implication for early genetic screening of adult-type hypolactasia.
21686221 2011 Theodore E. Woodward Award: lactase persistence SNPs in African populations regulate promoter activity in intestinal cell culture.
21365615 2011 Comparison of lactase persistence polymorphism in ancient and present-day Hungarian populations.
21340236 2010 LCT-22018G>A single nucleotide polymorphism is a better predictor of adult-type hypolactasia/lactase persistence in Japanese-Brazilians than LCT-13910C>T.
21327791 2011 The -14010*C variant associated with lactase persistence is located between an Oct-1 and HNF1? binding site and increases lactase promoter activity.
21193851 2011 Association of the LCT-13910C>T polymorphism with obesity and its modulation by dairy products in a Mediterranean population.
21136048 2011 Lactase gene c/t(-13910) polymorphism, calcium intake, and pQCT bone traits in Finnish adults.
21125297 2011 Longitudinal cell formation in the entire human small intestine is correlated with the localization of Hath1 and Klf4.
20960210 2011 13915*G DNA polymorphism associated with lactase persistence in Africa interacts with Oct-1.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20616560 2010 Genetic differences between five European populations.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20585563 2010 Body fat and dairy product intake in lactase persistent and non-persistent children and adolescents.
20509822 2010 The -13914G>A variant upstream of the lactase gene (LCT) is associated with lactase persistence/non-persistence.
20430969 2010 No influence of gene polymorphism of LCT (C13910T) on transplantation outcomes in acute myeloid leukemia patients who received transplantations from HLA-identical sibling donors.
20390408 2010 Analysis of three functional polymorphisms in relation to osteoporosis phenotypes: replication in a Spanish cohort.
20362522 2010 LCT-13910C>T polymorphism-associated lactose malabsorption and risk for colorectal cancer in Italy.
20225268 2010 The T-13910C polymorphism in the lactase phlorizin hydrolase gene is associated with differences in serum calcium levels and calcium intake.
20190720 2010 Adult-type hypolactasia genotyping in Northern Italy: prevalence of C/T-13910 polymorphism and questions after comparison with existing data.
20015952 2010 European lactase persistence genotype shows evidence of association with increase in body mass index.
19955176 2010 Structural hierarchy of regulatory elements in the folding and transport of an intestinal multidomain protein.
19947896 2010 The -22018A allele matches the lactase persistence phenotype in northern Chinese populations.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19889824 2010 Frequency of lactose malabsorption among healthy southern and northern Indian populations by genetic analysis and lactose hydrogen breath and tolerance tests.
19844753 2010 Associations between lactase persistence and the metabolic syndrome in a cross-sectional study in the Canary Islands.
19799794 2009 Frequency of LCT -13910C>T single nucleotide polymorphism associated with adult-type hypolactasia/lactase persistence among Brazilians of different ethnic groups.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19422935 2009 Genetic risk profiling and prediction of disease course in Crohn's disease patients.
19370782 2009 Prevalence of lactase persistent/non-persistent genotypes and milk consumption in a young population in north-west Russia.
19299182 2009 Gene polymorphisms and osteoporotic fractures: a study in postmenopausal French women.
19174780 2009 Confirmation of multiple Crohn's disease susceptibility loci in a large Dutch-Belgian cohort.
19168163 2009 Associations of genetic lactase non-persistence and sex with bone loss in young adulthood.
19161632 2009 Four novel mutations in the lactase gene (LCT) underlying congenital lactase deficiency (CLD).
19156157 2009 Prevalence of adult-type hypolactasia as diagnosed with genetic and lactose hydrogen breath tests in Hungarians.
19138442 2009 Genetic lactase non-persistence, consumption of milk products and intakes of milk nutrients in Finns from childhood to young adulthood.
19039706 2009 Impact of molecularly defined hypolactasia, self-perceived milk intolerance and milk consumption on bone mineral density in a population sample in Northern Europe.
19034520 2009 Lactose digestion and the evolutionary genetics of lactase persistence.
19010095 2009 Genetic test for lactase non-persistence and hydrogen breath test: is genotype better than phenotype to diagnose lactose malabsorption?
18980667 2008 Effects of the lactase 13910 C/T and calcium-sensor receptor A986S G/T gene polymorphisms on the incidence and recurrence of colorectal cancer in Hungarian population.
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
18940163 2008 [Diagnosing lactose intolerance in adults].
18704543 2009 LCT 13910 C/T polymorphism, serum calcium, and bone mineral density in postmenopausal women.
18605960 2008 Genetic testing for adult-type hypolactasia in Italian families.
18568133 2008 Concordance of genetic and breath tests for lactose intolerance in a tertiary referral centre.
18544679 2008 A single nucleotide polymorphism at chromosome 2q21.3 (LCT -13910C>T) associates with clinical outcome after allogeneic hematopoietic stem cell transplantation.
18468259 2008 Genes related to the metabolism of nutrients in the Kola Sami population.
18454942 2008 Synergistic effect of high lactase activity genotype and galactose-1-phosphate uridyl transferase (GALT) mutations on idiopathic presenile cataract formation.
18396155 2008 Evaluation of a novel reverse-hybridization StripAssay for typing DNA variants useful in diagnosis of adult-type hypolactasia.
18275674 2008 Measurement of breath hydrogen and methane, together with lactase genotype, defines the current best practice for investigation of lactose sensitivity.
18237552 2008 Single nucleotide polymorphism C/T(-13910), located upstream of the lactase gene, associated with adult-type hypolactasia: validation for clinical practice.
18194137 2008 Adult-type hypolactasia is not a predisposing factor for the early functional and structural changes of atherosclerosis: the Cardiovascular Risk in Young Finns Study.
18179885 2008 Independent introduction of two lactase-persistence alleles into human populations reflects different history of adaptation to milk culture.
18080747 2008 The LCT 13910 C/T polymorphism as a risk factor for osteoporosis, has no impact on metastatic bone disease in breast cancer.
18042517 2007 The lactase gene -13910T allele can not predict the lactase-persistence phenotype in north China.
18030226 2007 Decline of lactase activity and c/t-13910 variant in Sardinian childhood.
17934640 2007 Correlation between lactose absorption and the C/T-13910 and G/A-22018 mutations of the lactase-phlorizin hydrolase (LCT) gene in adult-type hypolactasia.
17911653 2007 The T/G 13915 variant upstream of the lactase gene (LCT) is the founder allele of lactase persistence in an urban Saudi population.
17706627 Lactase persistence/non-persistence variants, C/T_13910 and G/A_22018, as a diagnostic tool for lactose intolerance in IBS patients.
17701907 2007 Evidence of still-ongoing convergence evolution of the lactase persistence T-13910 alleles in humans.
17651714 2007 Pitfalls in LightCycler diagnosis of the single-nucleotide polymorphism 13.9 kb upstream of the lactase gene that is associated with adult-type hypolactasia.
17574225 2007 Hydrogen breath testing versus LCT genotyping for the diagnosis of lactose intolerance: a matter of age?
17507622 2007 Lactase persistence, dietary intake of milk, and the risk for prostate cancer in Sweden and Finland.
17478481 2007 Genotyping of the lactase-phlorizin hydrolase c/t-13910 polymorphism by means of a new rapid denaturing high-performance liquid chromatography-based assay in healthy subjects and colorectal cancer patients.
17451204 2007 Molecularly defined adult-type hypolactasia among working age people with reference to milk consumption and gastrointestinal symptoms.
17327935 2007 Prevalence and trends in adult-type hypolactasia in different age cohorts in Central Sweden diagnosed by genotyping for the adult-type hypolactasia-linked LCT -13910C > T mutation.
17311063 2007 Genetic testing improves the diagnosis of adult type hypolactasia in the Mediterranean population of Sardinia.
17159977 2007 Convergent adaptation of human lactase persistence in Africa and Europe.
17143950 2006 Lactase non-persistence and milk consumption in Estonia.
17120047 2007 A novel polymorphism associated with lactose tolerance in Africa: multiple causes for lactase persistence?
17020404 2006 Combining information from common type 2 diabetes risk polymorphisms improves disease prediction.
17015546 2006 The effects of adult-type hypolactasia on body height growth and dietary calcium intake from childhood into young adulthood: a 21-year follow-up study--the Cardiovascular Risk in Young Finns Study.
16876487 2007 Comparison of a real-time polymerase chain reaction assay for lactase genetic polymorphism with standard indirect tests for lactose maldigestion.
16400612 2006 Mutations in the translated region of the lactase gene (LCT) underlie congenital lactase deficiency.
16391332 2006 Genotyping of the lactase-phlorizin hydrolase -13910 polymorphism by LightCycler PCR and implications for the diagnosis of lactose intolerance.
16301215 2005 T-13910 DNA variant associated with lactase persistence interacts with Oct-1 and stimulates lactase promoter activity in vitro.
16109658 2005 Lactose intolerance: lactose tolerance test versus genotyping.
16024930 2005 Introducing genetic testing for adult-type hypolactasia.
15831909 2005 The C/C-13910 genotype of adult-type hypolactasia is associated with an increased risk of colorectal cancer in the Finnish population.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15716664 2005 Evaluation of a new DNA test compared with the lactose hydrogen breath test for the diagnosis of lactase non-persistence.
15667380 2005 Genetic variant of lactase-persistent C/T-13910 is associated with bone fractures in very old age.
15479673 2004 A genetic test which can be used to diagnose adult-type hypolactasia in children.
15365657 2004 Molecularly defined lactose malabsorption, peak bone mass and bone turnover rate in young finnish men.
15178553 2004 Complex regulation of the lactase-phlorizin hydrolase promoter by GATA-4.
15107297 2004 Transcriptional regulation of the lactase-phlorizin hydrolase promoter by PDX-1.
15106124 2004 The T allele of a single-nucleotide polymorphism 13.9 kb upstream of the lactase gene (LCT) (C-13.9kbT) does not predict or cause the lactase-persistence phenotype in Africans.
15054412 2004 The genetic variant of lactase persistence C (-13910) T as a risk factor for type I and II diabetes in the Finnish population.
14753735 2004 Genetic predisposition for adult lactose intolerance and relation to diet, bone density, and bone fractures.
12915462 2003 Lactase persistence DNA variant enhances lactase promoter activity in vitro: functional role as a cis regulatory element.
12795467 2003 The C/C(-13910) and G/G(-22018) genotypes for adult-type hypolactasia are not associated with inflammatory bowel disease.
12692047 2003 Transcriptional regulation of the lactase-phlorizin hydrolase gene by polymorphisms associated with adult-type hypolactasia.
12459179 2002 Novel interaction at the Cdx-2 binding sites of the lactase-phlorizin hydrolase promoter.
12011060 2002 Physical interaction between GATA-5 and hepatocyte nuclear factor-1alpha results in synergistic activation of the human lactase-phlorizin hydrolase promoter.
11788828 2002 Identification of a variant associated with adult-type hypolactasia.
11751874 2002 The prosequence of human lactase-phlorizin hydrolase modulates the folding of the mature enzyme.
10677375 2000 Interaction between the homeodomain proteins Cdx2 and HNF1alpha mediates expression of the lactase-phlorizin hydrolase gene.
8257087 1993 Regional localization of the lactase-phlorizin hydrolase gene, LCT, to chromosome 2q21.
7523415 1994 The pro region of human intestinal lactase-phlorizin hydrolase.
7487100 1995 Human lactase-phlorizin hydrolase: evidence of dimerization in the endoplasmic reticulum.
2460343 1988 Complete primary structure of human and rabbit lactase-phlorizin hydrolase: implications for biosynthesis, membrane anchoring and evolution of the enzyme.
1902057 1991 Structure of the chromosomal gene and cDNAs coding for lactase-phlorizin hydrolase in humans with adult-type hypolactasia or persistence of lactase.