Property Summary

NCBI Gene PubMed Count 29
PubMed Score 26.40
PubTator Score 18.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (7)

PMID Text
22277651 LCoR recruitment by KLF6 regulates expression of the cyclin-dependent kinase inhibitor CDKN1A gene.
21856747 Ligand-dependent corepressor acts as a novel androgen receptor corepressor, inhibits prostate cancer growth, and is functionally inactivated by the Src protein kinase.
21565892 These results showed that the presence of miR-615-3p repressed the expression of LCoR, a derepressor of peroxisome proliferator-activated receptor gamma (PPARgamma).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19744932 role for LCoR and CtBP1 as attenuators of progesterone-regulated transcription, but LCoR and CtBP1 can act to enhance transcription of some genes
19744931 HDAC6 can function as a cofactor of LCoR but they can act to enhance expression of specific estrogen-regulated genes
12535528 Data show that LCoR (ligand-dependent nuclear receptor corepressor) represents a class of corepressor that attenuates agonist-activated nuclear receptor signaling by multiple mechanisms [Ligand-dependent nuclear receptor corepressor].

AA Sequence

MQRMIQQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVR      1 - 70
KSQSEPSEQDGVLDLSTKKSPCAGSTSLSHSPGCSSTQGNGRPGRPSQYRPDGLRSGDGVPPRSLQDGTR     71 - 140
EGFGHSTSLKVPLARSLQISEELLSRNQLSTAASLGPSGLQNHGQHLILSREASWAKPHYEFNLSRMKFR    141 - 210
GNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVDLKIPQVRGMDLSWESRTGDQYSYSSLVM    211 - 280
GSQTESALSKKLRAILPKQSRKSMLDAGPDSWGSDAEQSTSGQPYPTSDQEGDPGSKQPRKKRGRYRQYN    281 - 350
SEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMRSEGPDVSVKIELDPQ    351 - 420
GEAAQSANESKNE                                                             421 - 433
//

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24550272 2014 Reciprocal interactions of human C10orf12 and C17orf96 with PRC2 revealed by BioTAP-XL cross-linking and affinity purification.
23502783 2013 The CCND1 c.870G>A polymorphism is a risk factor for t(11;14)(q13;q32) multiple myeloma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22277651 2012 Ligand-dependent corepressor (LCoR) recruitment by Kruppel-like factor 6 (KLF6) regulates expression of the cyclin-dependent kinase inhibitor CDKN1A gene.
21856747 2011 Ligand-dependent corepressor acts as a novel androgen receptor corepressor, inhibits prostate cancer growth, and is functionally inactivated by the Src protein kinase.
21565892 2011 miR-615-3p promotes the phagocytic capacity of splenic macrophages by targeting ligand-dependent nuclear receptor corepressor in cirrhosis-related portal hypertension.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19744932 2009 Ligand-dependent corepressor LCoR is an attenuator of progesterone-regulated gene expression.
19744931 2009 Function of histone deacetylase 6 as a cofactor of nuclear receptor coregulator LCoR.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15193453 2004 Corepressor recruitment by agonist-bound nuclear receptors.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12700765 2003 Coordinated histone modifications mediated by a CtBP co-repressor complex.
12560079 2003 Identification and characterization of Mlr1,2: two mouse homologues of Mblk-1, a transcription factor from the honeybee brain(1).
12535528 2003 Ligand-dependent nuclear receptor corepressor LCoR functions by histone deacetylase-dependent and -independent mechanisms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.