Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.11
PubTator Score 1.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
psoriasis 6514 4.012 1.35032722148748E-68
Disease Target Count P-value
osteosarcoma 7766 5.5e-07
diabetes mellitus 1683 1.7e-03
Atopic dermatitis 915 1.3e-02

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 4.600 1.4e-68
Atopic dermatitis 1.800 1.3e-02
diabetes mellitus 1.200 1.7e-03
osteosarcoma 1.219 5.5e-07

Gene RIF (4)

AA Sequence

MSCQQNQQQCQPPPKCPSPKCPPKSPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRPNS      1 - 70
CDRGSGQQGGGSGCGHGSGGCC                                                     71 - 92
//

Text Mined References (8)

PMID Year Title