Late cornified envelope protein 2C

Property Summary

NCBI Gene PubMed Count	4
PubMed Score	0.00

Knowledge Summary

Patent

No data available

Expression

Specificity
Differential

Skin - Sun Exposed (Lower leg) 17,968

Skin - Not Sun Exposed (Suprapubic) 18,081

Stomach 17,879

Vagina 17,834

Lung 18,057

Brain - Hypothalamus 18,169

Brain - Cerebellar Hemisphere 18,015

Brain - Frontal Cortex (BA9) 18,069

Colon - Sigmoid 18,089

Artery - Coronary 17,949

Ovary 17,971

Artery - Tibial 17,631

Esophagus - Gastroesophageal Junction 18,000

Whole Blood 17,439

Esophagus - Muscularis 18,017

Artery - Aorta 17,896

Adipose - Visceral (Omentum) 17,937

Cells - Transformed fibroblasts 17,577

Muscle - Skeletal 17,778

Testis 18,518

Prostate 18,213

Thyroid 18,024

Brain - Substantia nigra 17,981

Pituitary 18,147

Nerve - Tibial 18,007

Brain - Amygdala 18,006

Uterus 17,618

Adrenal Gland 18,071

Cells - EBV-transformed lymphocytes 18,186

Esophagus - Mucosa 18,076

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Putamen (basal ganglia) 17,863

Pancreas 18,123

Minor Salivary Gland 18,005

Spleen 17,614

Brain - Cerebellum 17,983

Colon - Transverse 17,825

Brain - Spinal cord (cervical c-1) 17,973

Brain - Cortex 18,039

Brain - Hippocampus 18,011

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Caudate (basal ganglia) 18,001

Breast - Mammary Tissue 18,103

Adipose - Subcutaneous 18,110

Heart - Left Ventricle 18,006

Liver 18,071

Heart - Atrial Appendage 17,896

breast 16,063

cervix, uterine 15,871

skeletal muscle 14,011

skin 16,206

testis 17,936

tonsil 15,400

Endocrine System 18,159

Female tissues 17,400

Skin and soft tissues 17,230

Blood and immune system 16,909

See source...

See source...

Synonym

Accession	Q5TA81
Symbols	LEP11

Gene

LCE2C

UniProt Keyword (3)

Complete proteome 20,231

Reference proteome 20,231

Keratinization 39

GO Function (1)

structural molecule activity 229

GO Component (2)

cytoplasm 4,094

cornified envelope 64

GO Process (3)

keratinocyte differentiation 72

peptide cross-linking 52

keratinization 182

Compartment GO Term (10)

Cell 16,178

Cell part 16,177

Cell periphery 5,381

Cornified envelope 68

Cytoplasm 10,983

Intracellular 14,108

Intracellular part 13,972

Membrane 8,530

Plasma membrane 5,829

cellular_component 18,320

HCA RNA Cell Line (4)

BJ 15,448

CACO-2 15,436

U-2197 16,483

SCLC-21H 17,139

Pathway (3)

Developmental Biology 1,026

Formation of the cornified envelope 74

Keratinization 216

Gene RIF (1)

AA Sequence

MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSSGGCCSSGAGG      1 - 70
CSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC                                   71 - 110
//

Text Mined References (4)

Summary
Details

	PMID	Year	Title