Property Summary

NCBI Gene PubMed Count 113
PubMed Score 169.36
PubTator Score 381.85

Knowledge Summary

Patent

No data available

TINX Plot

Expression

 GWAS Trait (1)

Gene RIF (68)

AA Sequence

MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSY      1 - 70
PPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSL     71 - 140
PPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESA    141 - 210
EASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN                      211 - 262
//

Text Mined References (118)

PMID Year Title