Property Summary

NCBI Gene PubMed Count 10
PubMed Score 11.50
PubTator Score 9.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.400 7.1e-06
osteosarcoma 1.406 2.8e-04
ependymoma -1.600 2.4e-11
glioblastoma -1.700 4.0e-06
atypical teratoid / rhabdoid tumor -1.900 4.7e-08
group 3 medulloblastoma -1.300 2.8e-03
medulloblastoma, large-cell -1.200 4.2e-05
lung cancer 1.300 3.2e-04
Breast cancer 3.300 2.4e-02
pediatric high grade glioma -1.400 7.5e-07
subependymal giant cell astrocytoma -2.163 5.9e-03
Pick disease -1.700 4.5e-05
progressive supranuclear palsy -1.600 1.4e-02
ovarian cancer -2.500 4.8e-08

Gene RIF (2)

PMID Text
22891245 Lanthionine synthetase C-like protein 1 interacts with and inhibits cystathionine beta-synthase: a target for neuronal antioxidant defense.
19528316 the crystal structures of human LanCL1, both free of and complexed with glutathione, revealing glutathione binding to a zinc ion at the putative active site formed by conserved GxxG motifs

AA Sequence

MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAV      1 - 70
LYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHL     71 - 140
NKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWY    141 - 210
QEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAP    211 - 280
GVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACK    281 - 350
FAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL                         351 - 399
//

Text Mined References (15)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22891245 2012 Lanthionine synthetase C-like protein 1 interacts with and inhibits cystathionine ?-synthase: a target for neuronal antioxidant defense.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19528316 2009 Structure of human lanthionine synthetase C-like protein 1 and its interaction with Eps8 and glutathione.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16979580 2006 Myristoylation of human LanC-like protein 2 (LANCL2) is essential for the interaction with the plasma membrane and the increase in cellular sensitivity to adriamycin.
15811525 2005 LANCL1, an erythrocyte protein recruited to the Maurer's clefts during Plasmodium falciparum development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15082773 2004 Normal development and fertility of knockout mice lacking the tumor suppressor gene LRP1b suggest functional compensation by LRP1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11474189 2001 Organization and chromosomal localization of the human and mouse genes coding for LanC-like protein 1 (LANCL1).
10944443 2000 Characterization of p40/GPR69A as a peripheral membrane protein related to the lantibiotic synthetase component C.
9512664 1998 Isolation, molecular characterization, and tissue-specific expression of a novel putative G protein-coupled receptor.