Property Summary

NCBI Gene PubMed Count 4
PubMed Score 7.13
PubTator Score 3.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
cutaneous lupus erythematosus 1.600 5.2e-03
astrocytoma -1.700 1.1e-16
glioblastoma -2.500 1.2e-04
oligodendroglioma -1.800 1.2e-14
medulloblastoma -2.600 4.4e-04
atypical teratoid / rhabdoid tumor -3.200 1.8e-11
medulloblastoma, large-cell -2.300 8.2e-04
primary pancreatic ductal adenocarcinoma 2.356 5.6e-03
non-small cell lung cancer 1.054 1.3e-07
intraductal papillary-mucinous adenoma (... 2.400 1.4e-02
breast carcinoma 1.700 1.3e-04
fibroadenoma 1.800 7.8e-03
interstitial cystitis 1.100 5.5e-03
pilocytic astrocytoma -1.300 2.1e-03
posterior fossa group A ependymoma 1.400 1.6e-03
invasive ductal carcinoma 1.419 1.6e-03
Pick disease -1.900 1.4e-03
Breast cancer 1.200 5.3e-05
ductal carcinoma in situ 1.800 1.9e-03
ovarian cancer 1.700 3.4e-02
pituitary cancer 4.100 4.1e-08
chronic rhinosinusitis -1.496 3.8e-02
pancreatic cancer 2.200 4.0e-04

AA Sequence

MDLQGRGVPSIDRLRVLLMLFHTMAQIMAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPY      1 - 70
DVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSK     71 - 140
VQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQP    141 - 210
FDIISDFVFSEEHKCPVDEREQLEETLPLILGLILGLVIMVTLAIYHVHHKMTANQVQIPRDRSQYKHMG    211 - 280
//

Text Mined References (6)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21642595 2011 BAD-LAMP is a novel biomarker of nonactivated human plasmacytoid dendritic cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.