Property Summary

NCBI Gene PubMed Count 4
PubMed Score 7.67
PubTator Score 3.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytoma -1.700 1.1e-16
Astrocytoma, Pilocytic -1.300 1.9e-03
atypical teratoid / rhabdoid tumor -3.200 1.8e-11
Breast cancer 1.200 5.3e-05
breast carcinoma 1.700 1.3e-04
chronic rhinosinusitis -1.496 3.8e-02
cutaneous lupus erythematosus 1.600 5.2e-03
ductal carcinoma in situ 1.800 1.9e-03
fibroadenoma 1.800 7.8e-03
glioblastoma -2.500 1.2e-04
group 3 medulloblastoma -2.300 7.8e-04
interstitial cystitis 1.100 5.5e-03
intraductal papillary-mucinous adenoma (... 2.400 1.4e-02
invasive ductal carcinoma 1.419 1.6e-03
medulloblastoma, large-cell -2.300 8.2e-04
non-small cell lung cancer 1.054 1.3e-07
oligodendroglioma -1.800 1.2e-14
ovarian cancer 1.700 3.4e-02
pancreatic cancer 2.200 4.0e-04
Pick disease -1.900 1.4e-03
pituitary cancer 4.100 4.1e-08
posterior fossa group A ependymoma 1.400 1.6e-03
primary pancreatic ductal adenocarcinoma 2.356 5.6e-03

AA Sequence

MDLQGRGVPSIDRLRVLLMLFHTMAQIMAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPY      1 - 70
DVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSK     71 - 140
VQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQP    141 - 210
FDIISDFVFSEEHKCPVDEREQLEETLPLILGLILGLVIMVTLAIYHVHHKMTANQVQIPRDRSQYKHMG    211 - 280
//

Text Mined References (6)

PMID Year Title