Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 1.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.5e-03
Atopic dermatitis 952 2.1e-02

AA Sequence

MTHCCSPCCQPTCCRTTCCRTTCWKPTTVTTCSSTPCCQPSCCVSSCCQPCCRPACCQNTCCRTTCCQPT      1 - 70
CLSSCCGQTSCGSSCGQSSSCAPVYCRRTCYYPTTVCLPGCLNQSCGSSCCQPCCRPACCETTCCRTTCF     71 - 140
QPTCVSSCCQPSCC                                                            141 - 154
//

Text Mined References (2)

PMID Year Title