Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Synonym

Accession Q3LI76 Q2M3F4
Symbols KAP15.1

PANTHER Protein Class (1)

  Ortholog (3)

 HCA RNA Cell Line (1)

AA Sequence

MSYNCSSGNFSSCCFGSYLRYPVSTYNLFYPSNAIYSPNTCQLGSSLYNGCQETYCEPTSCQTSCTLARS      1 - 70
YQTSCYCPKNSIFCSPRQTNYIRSLGCGNTGLGSLGCGSTGFQSLDCGSSFYHPTTFSSRNFQATCY        71 - 137
//

Text Mined References (3)

PMID Year Title