Property Summary

NCBI Gene PubMed Count 25
PubMed Score 11.86
PubTator Score 53.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis 3.748 2.7e-07
lung adenocarcinoma 1.200 1.1e-03
malignant mesothelioma 2.900 6.4e-09
psoriasis -1.400 4.9e-06

Gene RIF (9)

AA Sequence

MTCGSGFGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCGRSFGYRSGGV      1 - 70
CGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAFIDKVRFLEQQNKLLETKLQF     71 - 140
YQNRECCQSNLEPLFEGYIETLRREAECVEADSGRLASELNHVQEVLEGYKKKYEEEVSLRATAENEFVA    141 - 210
LKKDVDCAYLRKSDLEANVEALIQEIDFLRRLYEEEILILQSHISDTSVVVKLDNSRDLNMDCIIAEIKA    211 - 280
QYDDIVTRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAV    281 - 350
AQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEG    351 - 420
IGAVNVCVSSSRGGVVCGDLCVSGSRPVTGSVCSAPCNGNVAVSTGLCAPCGQLNTTCGGGSCGVGSCGI    421 - 490
SSLGVGSCGSSCRKC                                                           491 - 505
//

Text Mined References (26)

PMID Year Title