Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.17
PubTator Score 3.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.9e-11
Atopic dermatitis 952 2.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis -2.000 2.9e-02
psoriasis -1.900 2.9e-11

Gene RIF (1)

AA Sequence

MRSSVSRQTYSTKGGFSSNSASGGSGSQARTSFSSVTVSRSSGSGGGAHCGPGTGGFGSRSLYNLGGHKS      1 - 70
ISVSVAGGALLGRALGGFGFGSRAFMGQGAGRQTFGPACPPGGIQEVTVNQSLLTPLHVEIDPEIQRVRT     71 - 140
QEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQGQNLGVTRNNLEPLFEAYLGSMRSTLDRLQ    141 - 210
SERGRLDSELRNVQDLVEDFKNKYEDEINKHTAAENEFVVLKKDVDAAYMGRMDLHGKVGTLTQEIDFLQ    211 - 280
QLYEMELSQVQTHVSNTNVVLSMDNNRNLDLDSIIAEVKAQYELIAQRSRAEAEAWYQTKYEELQVTAGK    281 - 350
HGDNLRDTKNEIAELTRTIQRLQGEADAAKKQCQQLQTAIAEAEQRGELALKDAQKKLGDLDVALHQAKE    351 - 420
DLTRLLRDYQELMNVKLALDVEIATYRKLLESEESRMSGECPSAVSISVTGNSTTVCGGGAASFGGGISL    421 - 490
GGSGGATKGGFSTNVGYSTVKGGPVSAGTSILRKTTTVKTSSQRY                             491 - 535
//

Text Mined References (11)

PMID Year Title