Property Summary

NCBI Gene PubMed Count 10
PubMed Score 165.87
PubTator Score 12.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.234 2.6e-06
ovarian cancer -1.200 8.7e-06
psoriasis -1.400 6.5e-09

Gene RIF (7)

AA Sequence

MSRQLNIKSSGDKGNFSVHSAVVPRKAVGSLASYCAAGRGAGAGFGSRSLYSLGGNRRISFNVAGGGVRA      1 - 70
GGYGFRPGSGYGGGRASGFAGSMFGSVALGPACLSVCPPGGIHQVTVNKSLLAPLNVELDPEIQKVRAQE     71 - 140
REQIKVLNDKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKKNLEPILEGYISNLRKQLETLSGDRV    141 - 210
RLDSELRSMRDLVEDYKKRYEVEINRRTTAENEFVVLKKDADAAYAVKVELQAKVDSLDKEIKFLKCLYD    211 - 280
AEIAQIQTHASETSVILSMDNNRDLDLDSIIAEVRMHYEEIALKSKAEAEALYQTKIQELQLAASRHGDD    281 - 350
LKHTRSEMVELNRLIQRIRCEIGNVKKQRASLETAIADAEQRGDNALKDAQAKLDELEGALHQAKEELAR    351 - 420
MLREYQELMSLKLALDMEIATYRKLLEGEECRMSGENPSSVSISVISSSSYSYHHPSSAGVDLGASAVAG    421 - 490
SSGSTQSGQTKTTEARGGDLKDTQGKSTPASIPARKATR                                   491 - 529
//

Text Mined References (13)

PMID Year Title