Property Summary

NCBI Gene PubMed Count 5
PubMed Score 35.00
PubTator Score 9.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Visceral leishmaniasis 14 5.258 2.6

Expression

AA Sequence

MSFRLSGGSRRICSRTGSGRLSGGGTGFVAGNVCVGSGARSSFSCTLEGISSGGSFCNSGGGLGSGACAG      1 - 70
FLGNEHSLLSGNEKVTMQNLNDRLASYLDHVHALEEANADLEQKIKGWYEKCEPGSSREHDHDYSRYFSV     71 - 140
IEDLKRQIISATICNASIVLQNDNARLTADDFRLKYENELALHHSVEADTSGLRRVLDELTLCTTDLEIQ    141 - 210
CETLSEELTYLKKSHEEEMEVLQYTAGGNVNVEMNATPGVDLTVLLNNMRAEYEDLAEQNRKDAEAWFNE    211 - 280
RSATLQQQISDHEGAATAARNELTELKRNLQTLEIELQSLMAVKHSYECSLAETEGNYCNQLQQIQDQIG    281 - 350
VMEEQLQQIRTETEGQKLEYEQLLDVKIFLEKEIDIYCNLLDGEERKSKSTCYKSKGYRPVNSGNQAKDS    351 - 420
TEETIVKTVVEELDQIGNLLSLRVHSVEEKSSKISNITVEQRVPSKAP                          421 - 468
//

Text Mined References (6)

PMID Year Title