Property Summary

NCBI Gene PubMed Count 7
PubMed Score 16.41
PubTator Score 26.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.4e-66
colon cancer 1478 3.1e-09
cystic fibrosis 1696 7.9e-04
nasopharyngeal carcinoma 1058 1.0e-02
spina bifida 1074 1.9e-02
esophageal adenocarcinoma 737 3.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Hypohidrosis 34 4.395 2.2
Palmoplantar keratosis 74 3.301 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
colon cancer -3.100 3.1e-09
cystic fibrosis 2.400 7.9e-04
esophageal adenocarcinoma -2.400 3.5e-02
nasopharyngeal carcinoma -1.800 1.0e-02
psoriasis 6.900 1.4e-66
spina bifida -5.090 1.9e-02

Gene RIF (2)

AA Sequence

MSCSSRASSSRAGGSSSARVSAGGSSFSSGSRCGLGGSSAQGFRGGASSCSLSGGSSGAFGGSFGGGFGS      1 - 70
CSVGGGFGGASGSGTGFGGGSSFGGVSGFGRGSGFCGSSRFSSGATGGFYSYGGGMGGGVGDGGLFSGGE     71 - 140
KQTMQNLNDRLANYLDKVRALEEANTDLENKIKEWYDKYGPGSGDGGSGRDYSKYYSIIEDLRNQIIAAT    141 - 210
VENAGIILHIDNARLAADDFRLKYENELCLRQSVEADINGLRKVLDDLTMTRSDLEMQIESFTEELAYLR    211 - 280
KNHEEEMKNMQGSSGGEVTVEMNAAPGTDLTKLLNDMRAQYEELAEQNRREAEERFNKQSASLQAQISTD    281 - 350
AGAATSAKNEITELKRTLQALEIELQSQLAMKSSLEGTLADTEAGYVAQLSEIQTQISALEEEICQIWGE    351 - 420
TKCQNAEYKQLLDIKTRLEVEIETYRRLLDGEGGGSSFAEFGGRNSGSVNMGSRDLVSGDSRSGSCSGQG    421 - 490
RDSSKTRVTKTIVEELVDGKVVSSQVSSISEVKVK                                       491 - 525
//

Text Mined References (10)

PMID Year Title