Property Summary

NCBI Gene PubMed Count 6
PubMed Score 14.19
PubTator Score 26.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
esophageal adenocarcinoma -2.400 3.5e-02
colon cancer -3.100 3.1e-09
cystic fibrosis 2.400 7.9e-04
nasopharyngeal carcinoma -1.800 1.0e-02
spina bifida -5.090 1.9e-02
psoriasis 6.900 1.4e-66

Synonym

Accession Q2M2I5 Q9NXG7
Symbols K24
KA24

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
12230514 KRT24 encodes a new keratin protein that bears high similarity to the type I keratins and displays a unique expression profile; sequence aberrations were not found in Naegeli-Franceschetti-Jadassohn syndrome

AA Sequence

MSCSSRASSSRAGGSSSARVSAGGSSFSSGSRCGLGGSSAQGFRGGASSCSLSGGSSGAFGGSFGGGFGS      1 - 70
CSVGGGFGGASGSGTGFGGGSSFGGVSGFGRGSGFCGSSRFSSGATGGFYSYGGGMGGGVGDGGLFSGGE     71 - 140
KQTMQNLNDRLANYLDKVRALEEANTDLENKIKEWYDKYGPGSGDGGSGRDYSKYYSIIEDLRNQIIAAT    141 - 210
VENAGIILHIDNARLAADDFRLKYENELCLRQSVEADINGLRKVLDDLTMTRSDLEMQIESFTEELAYLR    211 - 280
KNHEEEMKNMQGSSGGEVTVEMNAAPGTDLTKLLNDMRAQYEELAEQNRREAEERFNKQSASLQAQISTD    281 - 350
AGAATSAKNEITELKRTLQALEIELQSQLAMKSSLEGTLADTEAGYVAQLSEIQTQISALEEEICQIWGE    351 - 420
TKCQNAEYKQLLDIKTRLEVEIETYRRLLDGEGGGSSFAEFGGRNSGSVNMGSRDLVSGDSRSGSCSGQG    421 - 490
RDSSKTRVTKTIVEELVDGKVVSSQVSSISEVKVK                                       491 - 525
//

Text Mined References (9)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17317818 2007 A susceptibility gene set for early onset colorectal cancer that integrates diverse signaling pathways: implication for tumorigenesis.
16831889 2006 New consensus nomenclature for mammalian keratins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12230514 2002 Refined mapping of Naegeli-Franceschetti- Jadassohn syndrome to a 6 cM interval on chromosome 17q11.2-q21 and investigation of candidate genes.