Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.03
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.3e-08
Pick disease 1894 8.6e-05
medulloblastoma, large-cell 6241 2.9e-04
osteosarcoma 7950 5.7e-03
lung cancer 4740 1.5e-02

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer -1.500 1.5e-02
medulloblastoma, large-cell -1.200 2.9e-04
osteosarcoma -1.438 5.7e-03
Pick disease -1.200 8.6e-05
psoriasis -1.100 1.3e-08

Synonym

Accession Q5JUW0 A8K0Y8 B3KU22 Q96EA3 Q9NXB1
Symbols ZNF673

Gene

  Ortholog (1)

Species Source Disease
OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (2)

AA Sequence

MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGYLVAKPDVIFRLGPGEESWMAD      1 - 70
GGTPVRTCAGEDRPEVWQVDEQIDHYKESQDKLPWQAAFIGKETLKDESGQESRTCRKSIYLSTEFDSVR     71 - 140
QRLPKYYSWEKAFKTSFKLSWSKWKLCKKER                                           141 - 171
//

Text Mined References (7)

PMID Year Title