Property Summary

NCBI Gene PubMed Count 17
PubMed Score 16.55
PubTator Score 13.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 3 medulloblastoma 1.700 3.9e-05
medulloblastoma, large-cell 1.800 6.7e-06
primitive neuroectodermal tumor 1.100 1.1e-03
adrenocortical carcinoma 1.251 6.0e-04
non-small cell lung cancer 1.557 2.2e-15
Breast cancer 1.500 4.1e-13
ovarian cancer 1.500 1.2e-05

Pathway (1)

Gene RIF (9)

PMID Text
27095104 Molecular requirements for the inter-subunit interaction and kinetochore recruitment of SKAP and Astrin have been reported.
26433880 KNSTRN Mutation, a Cutaneous Squamous Carcinoma-Specific Mutation is associated with Solid Tumors and Leukemias.
26348826 study reports presence of KNSTRN mutations in basal cell carcinomas (BCC); mutant KNSTRN disrupts sister chromatid cohesion and promotes genomic instability in functional assays; KNSTRN mutations in BCC appear to occur late in disease progression and are preferentially found in advanced tumors
26242911 Mechanistically, the N-terminal of SKAP binds to EB1, and its C terminus binds to IQGAP1 in migrating cells.
25194279 Findings suggest a role for kinetochore protein KNSTRN mutagenesis in cutaneous squamous cell carcinomas (SCCs) development.
24718257 These findings suggest that SKAP promotes ultraviolet rays-induced cell apoptosis by negatively regulating the anti-apoptotic protein Prp19.
23035123 SKAP constitutes a dynamic link between spindle microtubule plus-ends and mitotic chromosomes to achieve faithful cell division.
22110139 SKAP cooperates with CENP-E to orchestrate dynamic kinetochore-microtubule interaction for faithful chromosome segregation.
19667759 This paper identifies role of gene product of FLJ14502, named SKAP in the paper, in mitosis. SKAP promotes metaphase-to-anaphase transition by mediating seperase activation after spindle assembly checkpoint is satisfied in mitosis.

AA Sequence

MAAPEAPPLDRVFRTTWLSTECDSHPLPPSYRKFLFETQAADLAGGTTVAAGNLLNESEKDCGQDRRAPG      1 - 70
VQPCRLVTMTSVVKTVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITK     71 - 140
LRRENGQMKATDTATRRNVRKGYKPLSKQKSEEELKDKNQLLEAVNKQLHQKLTETQGELKDLTQKVELL    141 - 210
EKFRDNCLAILESKGLDPALGSETLASRQESTTDHMDSMLLLETLQEELKLFNETAKKQMEELQALKVKL    211 - 280
EMKEERVRFLEQQTLCNNQVNDLTTALKEMEQLLEM                                      281 - 316
//

Text Mined References (20)

PMID Year Title
27095104 2016 Molecular requirements for the inter-subunit interaction and kinetochore recruitment of SKAP and Astrin.
26433880 2016 Absence of KNSTRN Mutation, a Cutaneous Squamous Carcinoma-Specific Mutation, in Other Solid Tumors and Leukemias.
26348826 2015 Mutations in the Kinetochore Gene KNSTRN in Basal Cell Carcinoma.
26242911 2015 Signaling Scaffold Protein IQGAP1 Interacts with Microtubule Plus-end Tracking Protein SKAP and Links Dynamic Microtubule Plus-end to Steer Cell Migration.
25194279 2014 Recurrent point mutations in the kinetochore gene KNSTRN in cutaneous squamous cell carcinoma.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
24718257 2014 Small kinetochore associated protein (SKAP) promotes UV-induced cell apoptosis through negatively regulating pre-mRNA processing factor 19 (Prp19).
23035123 2012 Mitotic regulator SKAP forms a link between kinetochore core complex KMN and dynamic spindle microtubules.
22110139 2012 CENP-E kinesin interacts with SKAP protein to orchestrate accurate chromosome segregation in mitosis.
21402792 2011 The astrin-kinastrin/SKAP complex localizes to microtubule plus ends and facilitates chromosome alignment.
21269460 2011 Initial characterization of the human central proteome.
19667759 2009 SKAP associates with kinetochores and promotes the metaphase-to-anaphase transition.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15855057 2005 Analysis of differentially expressed genes in nitric oxide-exposed human monocytic cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.