Property Summary

NCBI Gene PubMed Count 15
PubMed Score 16.08
PubTator Score 5.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 1.7e-04
osteosarcoma 1.991 2.8e-09

Synonym

Accession B2CW77
Symbols CWS4
KILLIN

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (15)

AA Sequence

MDRPGPGSARPGRTVHVWGYRVEWKVRNGRKLQPSEWAGRGDLGGFKRRWKDTRATVGTTFRRRSRVSLV      1 - 70
GELSKFPLPSDSSGGKSSSSFARGALAWCRQRNPNPSCAAAETGARTSLPKERCRGWRLGNWLHKHPHPN     71 - 140
TCPRLPACWLPPILTERGERVPKLVPLLACYPKSKPKD                                    141 - 178
//

Text Mined References (16)

PMID Year Title