Property Summary

Ligand Count 7
NCBI Gene PubMed Count 70
PubMed Score 143.81
PubTator Score 102.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 4.0e-18
glioblastoma 5792 4.3e-05
psoriasis 6694 1.7e-04
osteosarcoma 7950 4.0e-04
pancreatic cancer 2398 6.0e-03
ovarian cancer 8520 6.2e-03
oligodendroglioma 2850 7.4e-03
astrocytic glioma 2597 9.8e-03
ependymoma 4679 1.3e-02
esophageal adenocarcinoma 737 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Netherton syndrome 15 5.546 2.8
Dermatitis 157 4.023 2.0
Cancer 2499 3.665 1.8

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.700 9.8e-03
Breast cancer -2.300 4.0e-18
ependymoma -2.000 1.3e-02
esophageal adenocarcinoma -2.700 2.3e-02
glioblastoma -1.600 4.3e-05
oligodendroglioma -1.900 7.4e-03
osteosarcoma 1.020 4.0e-04
ovarian cancer 1.200 6.2e-03
pancreatic cancer 1.500 6.0e-03
psoriasis 1.400 1.7e-04

Gene RIF (58)

AA Sequence

MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAH      1 - 70
CKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPP     71 - 140
GTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLV    141 - 210
CRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR                               211 - 253
//

Text Mined References (73)

PMID Year Title