Property Summary

NCBI Gene PubMed Count 65
PubMed Score 133.22
PubTator Score 102.41

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.700 9.8e-03
ependymoma -2.000 1.3e-02
oligodendroglioma -1.900 7.4e-03
esophageal adenocarcinoma -2.700 2.3e-02
psoriasis 1.800 1.6e-10
osteosarcoma 1.020 4.0e-04
glioblastoma -1.600 4.3e-05
pancreatic cancer 2.200 6.7e-04
Breast cancer -3.000 5.1e-22
ovarian cancer 1.400 1.2e-02

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
652039 screening 3330 / 0 / 365915 Fluorescence Intensity-based biochemical primary high throughput screening assay to identify activators of kallikrein-7 (K7) zymogen
652073 summary 0 / 0 / 0 Summary of the probe development effort to identify activators of kallikrein-7 (K7) zymogen
686949 screening 2186 / 0 / 1042 Fluorescence Intensity-based biochemical primary high throughput confirmation assay to identify activators of kallikrein-7 (K7) zymogen
720500 confirmatory 57 / 0 / 191 Fluorescence Intensity-based biochemical primary high throughput dose response assay to identify activators of kallikrein-7 (K7) zymogen

Gene RIF (54)

PMID Text
26231762 Data demonstrate that elevated levels of KLK6, KLK7 and KLK9 proteins are associated with poor glioblastoma patients survival.
26032414 Proteolytic cleavage of midkine, CYR61, and tenascin-C govern the pathophysiological roles of KLK7.
26022646 This report demonstrates that concurrent loss of KLK5 and KLK7 associates with a poor clinical outcome in Squamous-Cell Carcinoma and could therefore serve as prognostic marker in this disease.
25477184 KLK6 and KLK7 mRNA and protein overexpression is directly associated with early-stage ovarian tumors.
25448018 Daata indicate that the peptide Abz-NLY( downward arrow)RVE-Q-EDDnp is the best synthetic substrate for Kallikrein-related peptidase 7 (KLK7) [kcat/Km=455 (mMs)(-1)].
25182706 Our findings suggest that serum KLK7 may be a valuable diagnostic biomarker for cervical cancer, and may help to determine the individual prognosis of these patients.
25153388 These results demonstrate the aberrant expression of KLK7 in colon cancer cells and tissues and its involvement in cell proliferation in vitro and in vivo.
23495698 Prochemerin processing protease converts prochemerin into active chemerinF; the activating truncation by the protease may trigger a structural C-terminal rearrangement leading to increased affinity of chemerin to chemokine-like receptor (CMKLR)1.
23413953 Early-stage oral squamous cell carcinoma and high KLK7 mRNA levels were correlated with the rs10581213(wt/ins + ins/ins) genotypes
23224034 KLK7 and KLK14 gene expression can be regarded as markers of poor prognosis for colorectal cancer patients with discriminating power between CC and adenoma patients.
22825846 regulation of procaspase-14 maturation during terminal differentiation is a unique two-step process involving KLK7 and an activation intermediate of caspase-14.
22573795 High KLK7 expression is associated with pancreatic ductal adenocarcinoma.
22521249 The enhancement of protease activity through increased KLK7 expression by the TH2 cytokines IL-4 and IL-13 might be an important factor for mechanical and chemical epidermal barrier dysfunction in patients with atopic dermatitis.
21868565 Significant co-expression of KLKs 5 and 7 was observed in the same cancer samples. Increased KLK5 expression was a statistically significant independent prognostic factor for DFS and OS of patients
21616098 KLK7 may play an important role in the activation of MMP-9 in tumors that express high levels of both these proteases
21548205 Stromal cells can suppress the expression of the KLK7 gene in the epithelial cells in benign prostate hyperplasia.
21520985 Both KLK7 (P=0.026) and KLK11 (P<0.001) expressions were decreased in prostate cancer cells compared to normal/benign prostate cells
21168996 Our evidence suggests that the AACCins5874 insertion in the 3'untranslated region of the SCCE gene causes an over-expression in COS-7 and HeLa cells but does not have an effect on mRNA stability.
20944116 hK7 plays an important role in mediating prostate cancer progression
20544292 in the high-KLK7-expression group there was more progressive liver metastasis and more advanced clinical staging compared with the low-KLK7-expression group
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20424135 Observational study of gene-disease association. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20090765 expression and activity of KLK are under fine control and can be distinctly influenced by variables such as differentiation, calcium, vitamin D, and retinoic acid
19921697 Overexpression of kallikrein 7 is associated with cervical neoplasia.
19558318 Combination of KLK2, 3, 13, and 14 and KLK1, 2, 5, 6, 7, 8, 10, 13, and 14 showed very strong discriminatory potential for semen liquefaction and viscosity, respectively.
19453546 Parallel underexpression of KLK5 and KLK7 mRNA in breast malignancies is reported.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19350120 Data suggest that KLK7 gene is up-regulated in colon cancer and its expression predicts poor prognosis for colon cancer patients.
19118981 reduced expression of LEKTI and increased expression of SCCE and SCTE in human epidermal keratinocytes after UVB irradiation may contribute to desquamation of the stratum corneum.
19091121 expression of K7 in BxPC-3 cells resulted in increase in shedding of soluble desmoglein 2 consistent with notion that aberrant expression of K7 in pancreatic tumors may result in diminished cell adhesion & facilitate tumor cell invasion
19085836 kallikreins 5, 7, 8, and 10 are abundantly expressed in human OSCC and may be implicated in malignant progression
18976018 hK7 and ALP were decreased in malignant prostate epithelium.
18953252 Expression of kallikrein 7 diminishes pancreatic cancer cell adhesion to vitronectin and enhances urokinase-type plasminogen activator receptor shedding.
18774391 KLK7 insertion appears to confer no risk of eczema; no interaction between the SPINK5 risk allele or the putative KLK7 risk allele and FLG mutations was found
18774391 Observational study of gene-disease association. (HuGE Navigator)
18343220 KLK7 is able to cleave fibronectin in a time-dependent manner, but not laminin.
18329042 Data show that hK7 was crystallized, and its three-dimensional structure was solved in the absence of protease inhibitors. A model of the interaction between the protease and its inhibitor is proposed.
18325919 Expression of KLK7, a novel biomarker for advanced ovarian carcinoma, was determined by a novel in situ quantitative method.
18163887 predominant localisation of KLK5 and KLK7 in acinar cells of the exocrine pancreas; KLK5 and KLK7 generate transcripts in pancreas variant from those in skin or ovary
17989887 Observational study of gene-disease association. (HuGE Navigator)
17989887 in 99 children and adults with atopic dermatitis found that an association with KLK7 4bp insertion polymorphism was not confirmed.
17909180 x-ray structures of recombinant active K7 at medium and atomic resolution
17012259 KLK5 and KLK7 were shown to control activation of CAP18 and also influence further processing to smaller peptides with alternate biological activity; the balance of proteolytic activity at an epithelial interface will control innate immune defense
16628198 in majority of patients with Netherton syndrome, Dsg1 & Dsc1 were reduced in living layers of epidermis; SCTE-like & SCCE-like activities were increased, suggesting these proteases participate in premature degradation of corneodesmosomal cadherins
15766562 variability in KLK5 and KLK7 gene expression might be involved in lung tumorigenesis
15675955 in normal skin the LG system transports and secretes LEKTI earlier than KLK7 and KLK5 preventing premature loss of stratum corneum integrity/cohesion.
15297163 Squamous cervical cancer expressed high levels of SCCE, suggesting that this protease may play an important role in invasion and metastasis.
15191543 Observational study of gene-disease association. (HuGE Navigator)
15191543 The AACC insertion in the SCCE gene may result in a change to SCCE activity within the skin barrier so SCCE could have an important role in the development of atopic dermatitis.
15140227 SCCE directly cleaved corneodesmosin and desmocollin 1 but was unable to degrade desmoglein 1.
14972646 Among all kallikreins measured, detectable levels in cerebrospinal fluid are identified for kallikrein K7. The most notable difference is seen between controls and frontotemperol dementia patients and controls and Alzheimer patients.
14691584 human kallikrein 7 may have a role in breast carcnoma
12738725 High expression of KLK7 transcript with a long 3'-untranslated region is associated with ovarian cancer

AA Sequence

MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAH      1 - 70
CKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPP     71 - 140
GTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLV    141 - 210
CRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR                               211 - 253
//

Text Mined References (68)

PMID Year Title
26231762 2015 Prognostic significance of multiple kallikreins in high-grade astrocytoma.
26032414 2015 Novel Biological Substrates of Human Kallikrein 7 Identified through Degradomics.
26022646 2015 The Co-Expression of Kallikrein 5 and Kallikrein 7 Associates with Poor Survival in Non-HPV Oral Squamous-Cell Carcinoma.
25477184 2014 Kallikrein family proteases KLK6 and KLK7 are potential early detection and diagnostic biomarkers for serous and papillary serous ovarian cancer subtypes.
25448018 2015 Specificity studies on Kallikrein-related peptidase 7 (KLK7) and effects of osmolytes and glycosaminoglycans on its peptidase activity.
25182706 2014 Serum human kallikrein 7 represents a new marker for cervical cancer.
25153388 2014 Kallikrein-related peptidase 7 (KLK7) is a proliferative factor that is aberrantly expressed in human colon cancer.
23495698 2013 Proteolytic activation of prochemerin by kallikrein 7 breaks an ionic linkage and results in C-terminal rearrangement.
23413953 2013 Polymorphisms in Kallikrein7 and 10 genes and oral cancer risks in Taiwan betel quid chewers and smokers.
23370777 2013 Vaspin inhibits kallikrein 7 by serpin mechanism.
23224034 2013 Parallel overexpression and clinical significance of kallikrein-related peptidases 7 and 14 (KLK7KLK14) in colon cancer.
22825846 2012 Kallikrein-related peptidase-7 regulates caspase-14 maturation during keratinocyte terminal differentiation by generating an intermediate form.
22573795 2012 Expression of kallikrein-related peptidase 7 predicts poor prognosis in patients with unresectable pancreatic ductal adenocarcinoma.
22521249 2012 TH2 cytokines increase kallikrein 7 expression and function in patients with atopic dermatitis.
21868565 2011 Evaluation of kallikrein-related peptidase 5 expression and its significance for breast cancer patients: association with kallikrein-related peptidase 7 expression.
21616098 2011 Proteolytic action of kallikrein-related peptidase 7 produces unique active matrix metalloproteinase-9 lacking the C-terminal hemopexin domains.
21548205 2011 [Stromal cells inhibit Kallikrein 7 expression in the epithelial cells of benign prostate hyperplasia].
21520985 2011 Immunohistochemical localization and analysis of kallikrein-related peptidase 7 and 11 expression in paired cancer and benign foci in prostate cancer patients.
21168996 2011 The 3'-UTR AACCins5874 in the stratum corneum chymotryptic enzyme gene (SCCE/KLK7), associated with atopic dermatitis; causes an increased mRNA expression without altering its stability.
20944116 2010 Human kallikrein 7 induces epithelial-mesenchymal transition-like changes in prostate carcinoma cells: a role in prostate cancer invasion and progression.
20665732 2011 Correlation of the expression of human kallikrein-related peptidases 4 and 7 with the prognosis in oral squamous cell carcinoma.
20544292 2010 Clinical significance of human kallikrein7 gene expression in colorectal cancer.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20424135 2010 Blood biomarker levels to aid discovery of cancer-related single-nucleotide polymorphisms: kallikreins and prostate cancer.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20332224 2010 Kallikrein-related peptidase 7 promotes multicellular aggregation via the alpha(5)beta(1) integrin pathway and paclitaxel chemoresistance in serous epithelial ovarian carcinoma.
20090765 2010 Kallikrein expression and cathelicidin processing are independently controlled in keratinocytes by calcium, vitamin D(3), and retinoic acid.
19921697 2010 Analysis of human kallikrein 7 expression as a potential biomarker in cervical neoplasia.
19558318 2009 Association between kallikrein-related peptidases (KLKs) and macroscopic indicators of semen analysis: their relation to sperm motility.
19453546 2009 Parallel underexpression of kallikrein 5 and kallikrein 7 mRNA in breast malignancies.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19350120 2009 Clinical significance of kallikrein-related peptidase 7 (KLK7) in colorectal cancer.
19118981 2009 Dichotomous effect of ultraviolet B on the expression of corneodesmosomal enzymes in human epidermal keratinocytes.
19091121 2008 Desmoglein 2 is a substrate of kallikrein 7 in pancreatic cancer.
19085836 2009 Multiple kallikrein (KLK 5, 7, 8, and 10) expression in squamous cell carcinoma of the oral cavity.
18976018 2008 Expression of the serine protease kallikrein 7 and its inhibitor antileukoprotease is decreased in prostate cancer.
18953252 2008 Expression of kallikrein 7 diminishes pancreatic cancer cell adhesion to vitronectin and enhances urokinase-type plasminogen activator receptor shedding.
18774391 2008 Analysis of the individual and aggregate genetic contributions of previously identified serine peptidase inhibitor Kazal type 5 (SPINK5), kallikrein-related peptidase 7 (KLK7), and filaggrin (FLG) polymorphisms to eczema risk.
18343220 2008 The extracellular matrix protein fibronectin is a substrate for kallikrein 7.
18329042 2008 Crystal structure of human epidermal kallikrein 7 (hK7) synthesized directly in its native state in E. coli: insights into the atomic basis of its inhibition by LEKTI domain 6 (LD6).
18325919 2008 Human tissue kallikrein 7, a novel biomarker for advanced ovarian carcinoma using a novel in situ quantitative method of protein expression.
18163887 2008 Tissue-specific promoter utilisation of the kallikrein-related peptidase genes, KLK5 and KLK7, and cellular localisation of the encoded proteins suggest roles in exocrine pancreatic function.
17989887 2007 Analysis of SPINK 5, KLK 7 and FLG genotypes in a French atopic dermatitis cohort.
17909180 2007 Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.
17275179 2007 Human tissue kallikreins: the cancer biomarker family.
17012259 2006 Kallikrein-mediated proteolysis regulates the antimicrobial effects of cathelicidins in skin.
16800724 2006 A comprehensive nomenclature for serine proteases with homology to tissue kallikreins.
16800723 2006 Proceedings of the 1st International Symposium on Kallikreins, Lausanne, Switzerland, September 1-3 , 2005.
16628198 2006 Corneodesmosomal cadherins are preferential targets of stratum corneum trypsin- and chymotrypsin-like hyperactivity in Netherton syndrome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15766562 2005 KLK5 and KLK7, two members of the human tissue kallikrein family, are differentially expressed in lung cancer.
15675955 2005 LEKTI is localized in lamellar granules, separated from KLK5 and KLK7, and is secreted in the extracellular spaces of the superficial stratum granulosum.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15297163 2004 The serine protease stratum corneum chymotryptic enzyme (kallikrein 7) is highly overexpressed in squamous cervical cancer cells.
15191543 2004 Genetic association between an AACC insertion in the 3'UTR of the stratum corneum chymotryptic enzyme gene and atopic dermatitis.
15140227 2004 Degradation of corneodesmosome proteins by two serine proteases of the kallikrein family, SCTE/KLK5/hK5 and SCCE/KLK7/hK7.
14972646 2004 Altered kallikrein 7 and 10 concentrations in cerebrospinal fluid of patients with Alzheimer's disease and frontotemporal dementia.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691584 2004 Expression analysis of the human kallikrein 7 (KLK7) in breast tumors: a new potential biomarker for prognosis of breast carcinoma.
12738725 2003 Differential splicing of KLK5 and KLK7 in epithelial ovarian cancer produces novel variants with potential as cancer biomarkers.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11874483 2002 Epidermal overexpression of stratum corneum chymotryptic enzyme in mice: a model for chronic itchy dermatitis.
11054574 2000 Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region.
10974542 2000 The KLK7 (PRSS6) gene, encoding for the stratum corneum chymotryptic enzyme is a new member of the human kallikrein gene family - genomic characterization, mapping, tissue expression and hormonal regulation.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8393902 1993 Purification and preliminary characterization of stratum corneum chymotryptic enzyme: a proteinase that may be involved in desquamation.
8034709 1994 Cloning, expression, and characterization of stratum corneum chymotryptic enzyme. A skin-specific human serine proteinase.
7794273 1995 Primary substrate specificity of recombinant human stratum corneum chymotryptic enzyme.