Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.75
PubTator Score 0.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Anorexia nervosa 80 0.0 1.1

Expression

  Differential Expression (8)

Disease log2 FC p
aldosterone-producing adenoma -1.005 3.8e-02
ependymoma -1.100 5.4e-06
osteosarcoma 2.075 4.5e-06
ovarian cancer 1.100 1.8e-02
pancreatic cancer 1.400 7.2e-04
pancreatic carcinoma 1.400 7.2e-04
Rheumatoid arthritis 2.100 9.9e-03
ulcerative colitis -1.200 7.8e-06

Gene RIF (1)

AA Sequence

MASDSMSSKQARNHITKGKRQQQHQQIKNRSSISDGDGEDSFIFEANEAWKDFHGSLLRFYENGELCDVT      1 - 70
LKVGSKLISCHKLVLACVIPYFRAMFLSEMAEAKQTLIEIRDFDGDAIEDLVKFVYSSRLTLTVDNVQPL     71 - 140
LYAACILQVELVARACCEYMKLHFHPSNCLAVRAFAESHNRIDLMDMADQYACDHFTEVVECEDFVSVSP    141 - 210
QHLHKLLSSSDLNIENEKQVYNAAIKWLLANPQHHSKWLDETLAQVRLPLLPVDFLMGVVAKEQIVKQNL    211 - 280
KCRDLLDEARNYHLHLSSRAVPDFEYSIRTTPRKHTAGVLFCVGGRGGSGDPFRSIECYSINKNSWFFGP    281 - 350
EMNSRRRHVGVISVEGKVYAVGGHDGNEHLGSMEMFDPLTNKWMMKASMNTKRRGIALASLGGPIYAIGG    351 - 420
LDDNTCFNDVERYDIESDQWSTVAPMNTPRGGVGSVALVNHVYAVGGNDGMASLSSVERYDPHLDKWIEV    421 - 490
KEMGQRRAGNGVSKLHGCLYVVGGFDDNSPLSSVERYDPRSNKWDYVAALTTPRGGVGIATVMGKIFAVG    491 - 560
GHNGNAYLNTVEAFDPVLNRWELVGSVSHCRAGAGVAVCSCLTSQIRDVGHGSNNVVDCM              561 - 620
//

Text Mined References (18)

PMID Year Title