Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.56
PubTator Score 0.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 8.4e-08
psoriasis 6685 2.3e-07
spina bifida 1064 3.7e-02

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.142 8.4e-08
psoriasis 1.300 2.3e-07
spina bifida -1.212 3.7e-02

Synonym

Accession O94889 A8K612 Q7Z3E8 Q8N125
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MVEDGAEELEDLVHFSVSELPSRGYGVMEEIRRQGKLCDVTLKIGDHKFSAHRIVLAASIPYFHAMFTND      1 - 70
MMECKQDEIVMQGMDPSALEALINFAYNGNLAIDQQNVQSLLMGASFLQLQSIKDACCTFLRERLHPKNC     71 - 140
LGVRQFAETMMCAVLYDAANSFIHQHFVEVSMSEEFLALPLEDVLELVSRDELNVKSEEQVFEAALAWVR    141 - 210
YDREQRGPYLPELLSNIRLPLCRPQFLSDRVQQDDLVRCCHKCRDLVDEAKDYHLMPERRPHLPAFRTRP    211 - 280
RCCTSIAGLIYAVGGLNSAGDSLNVVEVFDPIANCWERCRPMTTARSRVGVAVVNGLLYAIGGYDGQLRL    281 - 350
STVEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLSSVETYSPETDKWTVVTSMSSNR    351 - 420
SAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAAGMLNKRCRHGAASLGSKMFVCGGYDGSGF    421 - 490
LSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSSVEMYDPETDCWTFMAPMACH    491 - 560
EGGVGVGCIPLLTI                                                            561 - 574
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.