Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
glioblastoma 2.400 3.4e-04
oligodendroglioma 1.200 2.1e-07
osteosarcoma -1.282 2.3e-02
group 3 medulloblastoma 3.600 1.5e-06
atypical teratoid / rhabdoid tumor 1.600 2.2e-03
medulloblastoma, large-cell 2.500 3.1e-03
primitive neuroectodermal tumor 2.300 1.2e-02
adrenocortical carcinoma -1.348 1.3e-02
adult high grade glioma 2.200 2.7e-05
pilocytic astrocytoma 1.200 3.3e-03
lung carcinoma 2.800 8.8e-42
gastric carcinoma -1.800 2.8e-03
ovarian cancer -1.800 2.5e-11
psoriasis -1.500 2.1e-22

Synonym

Accession Q8IYD2 B3KU70 Q9NVG5
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20133782 Upregulation of KLHDC8A provides an alternative pathway for xenograft tumors to maintain aggressiveness in the absence of EGFR dependence.

AA Sequence

MEVPNVKDFQWKRLAPLPSRRVYCSLLETGGQVYAIGGCDDNGVPMDCFEVYSPEADQWTALPRLPTARA      1 - 70
GVAVTALGKRIMVIGGVGTNQLPLKVVEMYNIDEGKWKKRSMLREAAMGISVTAKDYRVYAAGGMGLDLR     71 - 140
PHNHLQHYDMLKDMWVSLAPMPTPRYAATSFLRGSKIYVLGGRQSKYAVNAFEVFDIETRSWTKFPNIPY    141 - 210
KRAFSSFVTLDNHLYSLGGLRQGRLYRQPKFLRTMDVFDMEQGGWLKMERSFFLKKRRADFVAGSLSGRV    211 - 280
IVAGGLGNQPTVLETAEAFHPGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS    281 - 350
//

Text Mined References (6)

PMID Year Title
20133782 2010 Mutant EGFR is required for maintenance of glioma growth in vivo, and its ablation leads to escape from receptor dependence.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.