Property Summary

NCBI Gene PubMed Count 52
PubMed Score 25.55
PubTator Score 42.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.500 8.9e-03
atypical teratoid / rhabdoid tumor 1.200 9.8e-06
dermatomyositis 1.100 2.2e-04
glioblastoma 1.100 6.5e-04
ovarian cancer -1.500 7.8e-06
pancreatic ductal adenocarcinoma liver m... 1.320 3.8e-03
psoriasis 1.600 3.0e-05

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (34)

AA Sequence

MYDNMSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSN      1 - 70
MIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQ     71 - 140
LEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGGYEIP    141 - 210
ARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLND    211 - 280
ALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQ    281 - 350
NQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVD    351 - 420
DENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAA    421 - 490
MRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNGGVSGRASFCG    491 - 560
KRQQQQWPGRRHR                                                             561 - 573
//

Text Mined References (62)

PMID Year Title