Property Summary

NCBI Gene PubMed Count 49
PubMed Score 25.76
PubTator Score 42.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.600 3.0e-05
astrocytoma 1.500 8.9e-03
atypical teratoid / rhabdoid tumor 1.200 9.8e-06
glioblastoma 1.100 6.5e-04
pancreatic ductal adenocarcinoma liver m... 1.320 3.8e-03
ovarian cancer -1.500 7.8e-06
dermatomyositis 1.100 2.2e-04

 GWAS Trait (1)

Gene RIF (32)

PMID Text
25883527 The G allele and GG genotype of KLC1 rs8702 were significantly over-represented among cataract patients, as compared to healthy controls, and were associated with an odds ratio for cataract development.
25472445 BNIP-2 is a kinesin-1 adapter involved in vesicular transportation in the cytoplasm and that association with cargos depends on interaction of the CRAL-TRIO domain with membrane phosphatidylserine.
25209998 Microtubule-bound kinesin-1 and kinesin-3 motor domains were visualized at multiple steps in their ATPase cycles--including their nucleotide-free states--at approximately 7 A resolution using cryo-electron microscopy.
25082190 Dnm1L interacts with KLC1 through the tetratricopeptide repeat domains.
24497505 The expression levels of KLC1 variant E in brain and lymphocytes were significantly higher in Alzheimer's disease patients.
24116125 Studies indicate that FEZ1 (fasciculation and elongation protein zeta 1), SCOCO (short coiled-coil protein) and kinesins (kinesin heavy chain) are involved in biological transport process.
23776437 study provides evidence that the combined effect of three variants within the KLC1 gene may predispose to age-related cataract.
22470497 For the binding of cargos shared by KLC1, we propose a different site located within the groove but not involving N343.
22272245 Data suggest that KLC1 is required for normal neural differentiation, ensuring proper metabolism of AD-associated molecules APP and Tau and for proliferation of neural precursors (NPs).
21385839 Phosphorylation of KLC1 at serine 460 modulates binding and trafficking of calsyntenin-1.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20601096 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19911314 Results do not convincingly support kinesin light chain 1 (KLC1) as a major susceptibility gene in any of the studied diseases, although there is a small effect of KLC1 in relation to cataract.
19911314 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19717019 Observational study of gene-disease association. (HuGE Navigator)
19046961 The rs8702 variant of the kinesin light chain 1 genotype proved to exert strong amplifying effects on the occurrence and severity of leukoaraiosis in patients with long-lasting poorly controlled severe hypertension
19046961 Observational study of gene-disease association. (HuGE Navigator)
17999208 The KLC1 56836CC variant exerts a significant protective effect on the occurrence of multiple sclerosis.
17999208 Observational study of gene-disease association. (HuGE Navigator)
17977659 Observational study of gene-disease association. (HuGE Navigator)
17977659 The present finding supports the involvement of the cytoskeleton and KNS2 in the development of vascular white matter damage, thereby opening up novel fields in the research into leukariois.
17917076 Observational study of gene-disease association. (HuGE Navigator)
17825299 microtubule-dependent functions of von Hippel-Lindau tumour suppressor are influenced by kinesin-2
17653041 Observational study of gene-disease association. (HuGE Navigator)
17653041 KLC1 gene may be a novel susceptibility gene for age-related cataract.
17611642 Observational study of gene-disease association. (HuGE Navigator)
17611642 KNS2 gene may play a role during early stages of Alzheimer's disease pathogenesis.
15364413 Observational study of gene-disease association. (HuGE Navigator)
15364413 For a single nucleotide polymorphism (G58836C in intron 13) in the kinesin light-chain 1 (KNS2) gene, the association between Alzheimer's disease and the C allele is found to be significant.
12475239 The major binding site for kinesin light chain in kinesin heavy chain has been mapped to residues 789-813 at the C-terminal end of the heavy chain stalk domain.

AA Sequence

MYDNMSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSN      1 - 70
MIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQ     71 - 140
LEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGGYEIP    141 - 210
ARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLND    211 - 280
ALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQ    281 - 350
NQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVD    351 - 420
DENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAA    421 - 490
MRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNGGVSGRASFCG    491 - 560
KRQQQQWPGRRHR                                                             561 - 573
//

Text Mined References (59)

PMID Year Title
25898167 2015 BORC, a multisubunit complex that regulates lysosome positioning.
25883527 2015 The link between apolipoprotein E, presenilin 1, and kinesin light chain 1 gene polymorphisms and age-related cortical cataracts in the Chinese population.
25472445 2015 BNIP-2 binds phosphatidylserine, localizes to vesicles, and is transported by kinesin-1.
25416956 2014 A proteome-scale map of the human interactome network.
25209998 2014 Conserved mechanisms of microtubule-stimulated ADP release, ATP binding, and force generation in transport kinesins.
25082190 2014 Dynamin-1-like protein (Dnm1L) interaction with kinesin light chain 1 (KLC1) through the tetratricopeptide repeat (TPR) domains.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24497505 2014 Transcriptome analysis of distinct mouse strains reveals kinesin light chain-1 splicing as an amyloid-? accumulation modifier.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24116125 2013 Structural analysis of intermolecular interactions in the kinesin adaptor complex fasciculation and elongation protein zeta 1/ short coiled-coil protein (FEZ1/SCOCO).
23776437 2013 Association of a rare haplotype in Kinesin light chain 1 gene with age-related cataract in a han chinese population.
22470497 2012 Crystal structures of the tetratricopeptide repeat domains of kinesin light chains: insight into cargo recognition mechanisms.
22272245 2012 Kinesin light chain 1 suppression impairs human embryonic stem cell neural differentiation and amyloid precursor protein metabolism.
21925109 2011 Kinesin-1-mediated capsid disassembly and disruption of the nuclear pore complex promote virus infection.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21385839 2011 Phosphorylation of kinesin light chain 1 at serine 460 modulates binding and trafficking of calsyntenin-1.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20601096 2010 Single-nucleotide polymorphisms in DNA-repair genes and cutaneous melanoma.
20074060 2010 Cell-wide analysis of secretory granule dynamics in three dimensions in living pancreatic beta-cells: evidence against a role for AMPK-dependent phosphorylation of KLC1 at Ser517/Ser520 in glucose-stimulated insulin granule movement.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19911314 2010 Kinesin light chain 1 gene haplotypes in three conformational diseases.
19861499 2009 Cayman ataxia protein caytaxin is transported by kinesin along neurites through binding to kinesin light chains.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19717019 Evaluation of the genetic variants of kinesin motor protein in ischemic stroke.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19046961 2009 Gene-environmental effects behind leukoaraiosis: a silent genetic variant of the kinesin protein can be activated in a subject with poorly controlled long-lasting hypertension.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17999208 2007 A cytoskeleton motor protein genetic variant may exert a protective effect on the occurrence of multiple sclerosis: the janus face of the kinesin light-chain 1 56836CC genetic variant.
17977659 2007 Evaluation of the roles of the A185C and C406T kinesin light-chain 1 variants in the development of leukoaraiosis.
17917076 2007 A genetic variant in cytoskeleton motors amplifies susceptibility to leukoaraiosis in hypertensive smokers: gene-environmental interactions behind vascular white matter demyelinization.
17825299 2007 The von Hippel-Lindau tumour suppressor interacts with microtubules through kinesin-2.
17653041 2007 Variability in the kinesin light chain 1 gene may influence risk of age-related cataract.
17611642 2007 Kinesin gene variability may affect tau phosphorylation in early Alzheimer's disease.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17332754 2007 The novel cargo Alcadein induces vesicle association of kinesin-1 motor components and activates axonal transport.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16084724 2005 Analysis of the kinesin superfamily: insights into structure and function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15364413 2004 Association study of three polymorphisms of kinesin light-chain 1 gene with Alzheimer's disease.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14970196 2004 The early onset dystonia protein torsinA interacts with kinesin light chain 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12839500 2003 Alternatively spliced products of the human kinesin light chain 1 (KNS2) gene.
12800201 2003 Novel tumor antigens identified by autologous antibody screening of childhood medulloblastoma cDNA libraries.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475239 2002 The heavy chain of conventional kinesin interacts with the SNARE proteins SNAP25 and SNAP23.
10806115 2000 An isoform of kinesin light chain specific for the Golgi complex.
9450959 1998 A specific light chain of kinesin associates with mitochondria in cultured cells.
8945637 1996 Human kinesin light (beta) chain gene: DNA sequence and functional characterization of its promoter and first exon.
8786116 1996 Localization of the human kinesin light chain gene (KNS2) to chromosome 14q32.3 by fluorescence in situ hybridization.
8274221 1993 Cloning and genetic characterization of the human kinesin light-chain (KLC) gene.