Property Summary

NCBI Gene PubMed Count 22
PubMed Score 21.53
PubTator Score 16.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -1.436 1.9e-03
adult high grade glioma 1.600 1.1e-05
Astrocytoma, Pilocytic 1.300 3.8e-05
atypical teratoid / rhabdoid tumor 1.900 4.9e-04
Breast cancer -1.300 3.8e-06
breast carcinoma -1.100 2.4e-21
gastric carcinoma 1.300 8.1e-03
glioblastoma 1.700 1.1e-08
interstitial lung disease 1.300 2.5e-03
intraductal papillary-mucinous adenoma (... -1.300 1.5e-02
invasive ductal carcinoma -2.000 3.8e-04
medulloblastoma 1.300 6.1e-04
medulloblastoma, large-cell 1.400 1.1e-04
osteosarcoma 1.834 8.9e-06
ovarian cancer -1.400 4.5e-04
pancreatic cancer 1.300 1.3e-02
posterior fossa group A ependymoma 1.200 6.6e-08
primary pancreatic ductal adenocarcinoma 1.454 9.3e-03
primitive neuroectodermal tumor 2.100 2.6e-04
subependymal giant cell astrocytoma 1.345 2.7e-02

Protein-protein Interaction (1)

Gene RIF (11)

AA Sequence

MLSLLVWILTLSDTFSQGTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAWP      1 - 70
RYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPEDTRIDGGPVILLQAGTPHN     71 - 140
LTCRAFNAKPAATIIWFRDGTQQEGAVASTELLKDGKRETTVSQLLINPTDLDIGRVFTCRSMNEAIPSG    141 - 210
KETSIELDVHHPPTVTLSIEPQTVQEGERVVFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSF    211 - 280
FTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVL    281 - 350
SNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGDGGKVECFIGSTPP    351 - 420
PDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEER    421 - 490
EVLPVGIIAGATIGASILLIFFFIALVFFLYRRRKGSRKDVTLRKLDIKVETVNREPLTMHSDREDDTAS    491 - 560
VSTATRVMKAIYSSFKDDVDLKQDLRCDTIDTREEYEMKDPTNGYYNVRAHEDRPSSRAVLYADYRAPGP    561 - 630
ARFDGRPSSRLSHSSGYAQLNTYSRGPASDYGPEPTPPGPAAPAGTDTTSQLSYENYEKFNSHPFPGAAG    631 - 700
YPTYRLGYPQAPPSGLERTPYEAYDPIGKYATATRFSYTSQHSDYGQRFQQRMQTHV                 701 - 757
//

Text Mined References (26)

PMID Year Title