Property Summary

NCBI Gene PubMed Count 107
PubMed Score 28.52
PubTator Score 59.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.600 1.1e-03

Gene RIF (94)

AA Sequence

MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPI      1 - 70
FHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETV     71 - 140
ILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPS    141 - 210
DPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADF    211 - 280
PLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIF    281 - 350
LFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKT    351 - 420
PLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF                                       421 - 455
//

Text Mined References (107)

PMID Year Title