Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.73
PubTator Score 3.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 7.8e-80
Disease Target Count Z-score Confidence
Aphasia 22 3.172 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 7.8e-80

Gene RIF (4)

PMID Text
26290419 Kif24 is a physiological substrate of Nek2, which regulates cilia disassembly through a concerted mechanism involving Kif24-mediated microtubule depolymerization.
21620453 Study found that loss of Kif24 leads to the disappearance of CP110 from mother centrioles in cycling cells able to form cilia; thus, identifying a centriolar kinesin that specifically remodels a subset of microtubules, thereby regulating cilia assembly.
20670673 KIF24 rs17350674 polymorphism likely acts as a risk factor for sporadic Lobar Degeneration
20670673 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASWLYECLCEAELAQYYSHFTALGLQKIDELAKITMKDYSKLGVHDMNDRKRLFQLIKIIKIMQEEDKA      1 - 70
VSIPERHLQTSSLRIKSQELRSGPRRQLNFDSPADNKDRNASNDGFEMCSLSDFSANEQKSTYLKVLEHM     71 - 140
LPDDSQYHTKTGILNATAGDSYVQTEISTSLFSPNYLSAILGDCDIPIIQRISHVSGYNYGIPHSCIRQN    141 - 210
TSEKQNPWTEMEKIRVCVRKRPLGMREVRRGEINIITVEDKETLLVHEKKEAVDLTQYILQHVFYFDEVF    211 - 280
GEACTNQDVYMKTTHPLIQHIFNGGNATCFAYGQTGAGKTYTMIGTHENPGLYALAAKDIFRQLEVSQPR    281 - 350
KHLFVWISFYEIYCGQLYDLLNRRKRLFAREDSKHMVQIVGLQELQVDSVELLLEVILKGSKERSTGATG    351 - 420
VNADSSRSHAVIQIQIKDSAKRTFGRISFIDLAGSERAADARDSDRQTKMEGAEINQSLLALKECIRALD    421 - 490
QEHTHTPFRQSKLTQVLKDSFIGNAKTCMIANISPSHVATEHTLNTLRYADRVKELKKGIKCCTSVTSRN    491 - 560
RTSGNSSPKRIQSSPGALSEDKCSPKKVKLGFQQSLTVAAPGSTRGKVHPLTSHPPNIPFTSAPKVSGKR    561 - 630
GGSRGSPSQEWVIHASPVKGTVRSGHVAKKKPEESAPLCSEKNRMGNKTVLGWESRASGPGEGLVRGKLS    631 - 700
TKCKKVQTVQPVQKQLVSRVELSFGNAHHRAEYSQDSQRGTPARPASEAWTNIPPHQKEREEHLRFYHQQ    701 - 770
FQQPPLLQQKLKYQPLKRSLRQYRPPEGQLTNETPPLFHSYSENHDGAQVEELDDSDFSEDSFSHISSQR    771 - 840
ATKQRNTLENSEDSFFLHQTWGQGPEKQVAERQQSLFSSPRTGDKKDLTKSWVDSRDPINHRRAALDHSC    841 - 910
SPSKGPVDWSRENSTSSGPSPRDSLAEKPYCSQVDFIYRQERGGGSSFDLRKDASQSEVSGENEGNLPSP    911 - 980
EEDGFTISLSHVAVPGSPDQRDTVTTPLREVSADGPIQVTSTVKNGHAVPGEDPRGQLGTHAEYASGLMS    981 - 1050
PLTMSLLENPDNEGSPPSEQLVQDGATHSLVAESTGGPVVSHTVPSGDQEAALPVSSATRHLWLSSSPPD   1051 - 1120
NKPGGDLPALSPSPIRQHPADKLPSREADLGEACQSRETVLFSHEHMGSEQYDADAEETGLDGSWGFPGK   1121 - 1190
PFTTIHMGVPHSGPTLTPRTGSSDVADQLWAQERKHPTRLGWQEFGLSTDPIKLPCNSENVTWLKPRPIS   1191 - 1260
RCLARPSSPLVPSCSPKTAGTLRQPTLEQAQQVVIRAHQEQLDEMAELGFKEETLMSQLASNDFEDFVTQ   1261 - 1330
LDEIMVLKSKCIQSLRSQLQLYLTCHGPTAAPEGTVPS                                   1331 - 1368
//

Text Mined References (17)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26290419 2015 Nek2 activation of Kif24 ensures cilium disassembly during the cell cycle.
25416956 2014 A proteome-scale map of the human interactome network.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21620453 2011 Centriolar kinesin Kif24 interacts with CP110 to remodel microtubules and regulate ciliogenesis.
20670673 2010 Is KIF24 a genetic risk factor for Frontotemporal Lobar Degeneration?
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11416179 2001 All kinesin superfamily protein, KIF, genes in mouse and human.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.