Property Summary

Ligand Count 37
NCBI Gene PubMed Count 580
PubMed Score 1538.49
PubTator Score 1696.24

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (8)

PDB (73)

Gene RIF (585)

AA Sequence

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGG      1 - 70
AQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA                              71 - 115
//

Text Mined References (591)

PMID Year Title