Property Summary

NCBI Gene PubMed Count 33
PubMed Score 29.55
PubTator Score 34.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
posterior fossa group A ependymoma 1.600 9.5e-08
glioblastoma 2.200 5.8e-05
sonic hedgehog group medulloblastoma 2.900 2.7e-09
atypical teratoid / rhabdoid tumor 2.400 2.1e-06
medulloblastoma, large-cell 2.300 1.6e-06
primitive neuroectodermal tumor 2.500 8.5e-06
Atopic dermatitis 1.500 3.6e-04
adrenocortical carcinoma 1.407 1.6e-03
non-small cell lung cancer 1.319 3.1e-15
lung cancer 3.800 1.4e-06
colon cancer 2.300 1.8e-03
active Crohn's disease 1.004 7.9e-03
pediatric high grade glioma 2.000 1.5e-05
nasopharyngeal carcinoma 1.300 6.7e-04
Breast cancer 1.300 2.9e-06
ovarian cancer 1.200 5.3e-04
psoriasis 1.700 2.2e-90

Gene RIF (19)

PMID Text
25884224 Confocal microscopy shows that cells expressing SUMO-resistant Kif18A display a compromised dissociation of BubR1 from kinetochores after anaphase onset.
25431949 a biomarker for hepatocellular carcinoma diagnosis and an independent predictor of overall survival
25281536 that the human mitotic kinesin-8, KIF18A, directly interacts with PP1gamma through a conserved RVxF motif
25208566 data support a model in which microtubule-attenuating kinesins are molecularly "tuned" to control the dynamics of specific subsets of spindle microtubules
25048371 Cdk1-mediated inhibitory phosphorylation of Kif18A promotes chromosome oscillations in early metaphase. PP1 induces metaphase plate thinning by directly dephosphorylating Kif18A.
23746518 the motion of yeast (Kip3) and human (Kif18A) kinesin-8s
23288039 Mechanisms controlling the temporal degradation of Nek2A and Kif18A by the APC/C-Cdc20 complex.
22595673 Kif18A (kinesin-8) attenuates centromere movement by directly promoting microtubule pausing in a concentration- dependent manner.
22104080 there is a mutual regulation of kinetochore MT plus-end dynamics and Kif18A accumulation, which may contribute to the highly regulated and ordered changes in kinetochore spindle microtubule dynamics during chromosome congression and oscillation
21885282 Kif18A controls spindle length independently of its role in chromosome positioning. This is mediated by an ATP-independent spindle microtubule (MT) binding site at C-terminal end of the Kif18A tail that has a strong affinity for MTs in vitro and in cells.
21884977 The heightened processivity of Kif18A, conferred by its tail domain, thus promotes concentration of Kif18A at K-MT plus ends, where it suppresses their dynamics to control chromosome movements.
21231887 Kinesin (KIF18A) can be potentially used as a blood biomarker to identify asbestosis patients at risk of developing lung cancer.
21213216 Kif18A overexpression is associated with colorectal cancer progression.
20595236 High Kif18A is associated with breast carcinogenesis.
20153196 The kinesin-8 Kif18A dampens microtubule plus-end dynamics.
19625775 Studies strongly suggest that chromosome congression defects as the result of KIF18A depletion is at least in part mediated through destabilizing kinetochore CENP-E.
18680169 The current study sheds light on MS-KIF18A a microtubule-dependent kinesin and adds insights on the post-translational modifications that potentially control the protein cellular distribution and its co-association with cytoskeletal proteins.
18267093 Kif18A regulates kinetochore microtubule dynamics to control mitotic chromosome positioning.
17346968 Kif18A is a dual-functional kinesin and a key component of chromosome congression.

AA Sequence

MSVTEEDLCHHMKVVVRVRPENTKEKAAGFHKVVHVVDKHILVFDPKQEEVSFFHGKKTTNQNVIKKQNK      1 - 70
DLKFVFDAVFDETSTQSEVFEHTTKPILRSFLNGYNCTVLAYGATGAGKTHTMLGSADEPGVMYLTMLHL     71 - 140
YKCMDEIKEEKICSTAVSYLEVYNEQIRDLLVNSGPLAVREDTQKGVVVHGLTLHQPKSSEEILHLLDNG    141 - 210
NKNRTQHPTDMNATSSRSHAVFQIYLRQQDKTASINQNVRIAKMSLIDLAGSERASTSGAKGTRFVEGTN    211 - 280
INRSLLALGNVINALADSKRKNQHIPYRNSKLTRLLKDSLGGNCQTIMIAAVSPSSVFYDDTYNTLKYAN    281 - 350
RAKDIKSSLKSNVLNVNNHITQYVKICNEQKAEILLLKEKLKAYEEQKAFTNENDQAKLMISNPQEKEIE    351 - 420
RFQEILNCLFQNREEIRQEYLKLEMLLKENELKSFYQQQCHKQIEMMCSEDKVEKATGKRDHRLAMLKTR    421 - 490
RSYLEKRREEELKQFDENTNWLHRVEKEMGLLSQNGHIPKELKKDLHCHHLHLQNKDLKAQIRHMMDLAC    491 - 560
LQEQQHRQTEAVLNALLPTLRKQYCTLKEAGLSNAAFESDFKEIEHLVERKKVVVWADQTAEQPKQNDLP    561 - 630
GISVLMTFPQLGPVQPIPCCSSSGGTNLVKIPTEKRTRRKLMPSPLKGQHTLKSPPSQSVQLNDSLSKEL    631 - 700
QPIVYTPEDCRKAFQNPSTVTLMKPSSFTTSFQAISSNINSDNCLKMLCEVAIPHNRRKECGQEDLDSTF    701 - 770
TICEDIKSSKCKLPEQESLPNDNKDILQRLDPSSFSTKHSMPVPSMVPSYMAMTTAAKRKRKLTSSTSNS    771 - 840
SLTADVNSGFAKRVRQDNSSEKHLQENKPTMEHKRNICKINPSMVRKFGRNISKGNLR                841 - 898
//

Text Mined References (39)

PMID Year Title
25884224 2015 Sumoylation of Kif18A plays a role in regulating mitotic progression.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25431949 2014 High KIF18A expression correlates with unfavorable prognosis in primary hepatocellular carcinoma.
25281536 2014 The human mitotic kinesin KIF18A binds protein phosphatase 1 (PP1) through a highly conserved docking motif.
25208566 2014 A unique kinesin-8 surface loop provides specificity for chromosome alignment.
25048371 2014 Pre-anaphase chromosome oscillations are regulated by the antagonistic activities of Cdk1 and PP1 on Kif18A.
23746518 2013 Kinesin-8 is a low-force motor protein with a weakly bound slip state.
23288039 2013 Mechanisms controlling the temporal degradation of Nek2A and Kif18A by the APC/C-Cdc20 complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22595673 2012 Kif18A and chromokinesins confine centromere movements via microtubule growth suppression and spatial control of kinetochore tension.
22104080 2011 Microtubule stabilization triggers the plus-end accumulation of Kif18A/kinesin-8.
21885282 2011 Kif18A uses a microtubule binding site in the tail for plus-end localization and spindle length regulation.
21884977 2011 A tethering mechanism controls the processivity and kinetochore-microtubule plus-end enrichment of the kinesin-8 Kif18A.
21231887 2011 Proteomic detection of cancer in asbestosis patients using SELDI-TOF discovered serum protein biomarkers.
21213216 2011 Kinesin 18A expression: clinical relevance to colorectal cancer progression.
20595236 2010 Kif18A is involved in human breast carcinogenesis.
20153196 2010 The kinesin-8 Kif18A dampens microtubule plus-end dynamics.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19636373 2009 The regulation of MS-KIF18A expression and cross talk with estrogen receptor.
19625775 2009 Defects in chromosome congression and mitotic progression in KIF18A-deficient cells are partly mediated through impaired functions of CENP-E.
18680169 2008 New insights on cellular distribution, microtubule interactions and post-translational modifications of MS-KIF18A.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18513970 2008 Kinesin-8 molecular motors: putting the brakes on chromosome oscillations.
18267093 2008 The kinesin-8 motor Kif18A suppresses kinetochore movements to control mitotic chromosome alignment.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17346968 2007 The human kinesin Kif18A is a motile microtubule depolymerase essential for chromosome congression.
17006958 2007 MS-KIF18A, a kinesin, is associated with estrogen receptor.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15878648 2005 MS-KIF18A, new kinesin; structure and cellular expression.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.