Property Summary

NCBI Gene PubMed Count 12
PubMed Score 66.34
PubTator Score 23.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.2e-05
Disease Target Count Z-score Confidence
psoriasis 6685 0.0 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.500 1.2e-04
osteosarcoma -1.345 1.2e-05

 GO Function (1)

Gene RIF (5)

PMID Text
25953853 This study presents the crystal structure of human MRPP3, which features a remarkably distorted and hence non-productive active site that authors propose will switch to a fully productive state only upon association with MRPP1, MRPP2 and pre-tRNA substrate.
24763589 using a genome-wide association study, found that posttranscriptional modification of functionally important sites in mitochondrial transfer RNAs (tRNAs) is under strong genetic control, largely driven by a missense mutation in MRPP3
23755257 Inhibition of mitochondrial RNase P by beta-amyloid is an unspecific effect and is not mediated by beta-amyloid interaction with SDR5C1.
19624571 Haplotypes in KIAA0391 and PSMA6 genes is a genetic link for myocardial infarction and coronary artery disease.
19624571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTFYLFGIRSFPKLWKSPYLGLGPGHSYVSLFLADRCGIRNQQRLFSLKTMSPQNTKATNLIAKARYLRK      1 - 70
DEGSNKQVYSVPHFFLAGAAKERSQMNSQTEDHALAPVRNTIQLPTQPLNSEEWDKLKEDLKENTGKTSF     71 - 140
ESWIISQMAGCHSSIDVAKSLLAWVAAKNNGIVSYDLLVKYLYLCVFHMQTSEVIDVFEIMKARYKTLEP    141 - 210
RGYSLLIRGLIHSDRWREALLLLEDIKKVITPSKKNYNDCIQGALLHQDVNTAWNLYQELLGHDIVPMLE    211 - 280
TLKAFFDFGKDIKDDNYSNKLLDILSYLRNNQLYPGESFAHSIKTWFESVPGKQWKGQFTTVRKSGQCSG    281 - 350
CGKTIESIQLSPEEYECLKGKIMRDVIDGGDQYRKTTPQELKRFENFIKSRPPFDVVIDGLNVAKMFPKV    351 - 420
RESQLLLNVVSQLAKRNLRLLVLGRKHMLRRSSQWSRDEMEEVQKQASCFFADDISEDDPFLLYATLHSG    421 - 490
NHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTFQRILSYDTVVQTTGDSWHIPY    491 - 560
DEDLVERCSCEVPTKWLCLHQKT                                                   561 - 583
//

Text Mined References (18)

PMID Year Title
25953853 2015 Structure of the nuclease subunit of human mitochondrial RNase P.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24763589 2014 High-resolution genomic analysis of human mitochondrial RNA sequence variation.
23755257 2013 The amyloid-?-SDR5C1(ABAD) interaction does not mediate a specific inhibition of mitochondrial RNase P.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20953189 2010 Genome-wide association analysis identifies three psoriasis susceptibility loci.
19624571 2009 Haplotypes encompassing the KIAA0391 and PSMA6 gene cluster confer a genetic link for myocardial infarction and coronary artery disease.
18984158 2008 RNase P without RNA: identification and functional reconstitution of the human mitochondrial tRNA processing enzyme.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
17114934 The NYN domains: novel predicted RNAses with a PIN domain-like fold.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.