Property Summary

NCBI Gene PubMed Count 16
PubMed Score 16.02
PubTator Score 8.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.000 2.7e-06
Astrocytoma, Pilocytic -1.800 4.6e-10
atypical teratoid / rhabdoid tumor -2.200 5.1e-06
dermatomyositis 1.100 1.0e-02
ependymoma -1.500 1.3e-09
gastric cancer 1.200 1.5e-04
glioblastoma -1.700 6.0e-07
group 4 medulloblastoma -1.100 9.1e-04
invasive ductal carcinoma -1.100 1.4e-03
malignant mesothelioma 2.900 3.4e-08
medulloblastoma, large-cell -1.400 1.8e-05
Multiple myeloma 1.553 8.7e-03
osteosarcoma -1.160 5.7e-04
ovarian cancer -2.000 3.4e-07
primitive neuroectodermal tumor -1.100 2.2e-02
psoriasis -1.200 2.6e-09
severe Alzheimer's disease -1.298 3.5e-02
subependymal giant cell astrocytoma -1.774 4.1e-02

Gene RIF (6)

AA Sequence

MAAAAASASQDELNQLERVFLRLGHAETDEQLQNIISKFLPPVLLKLSSTQEGVRKKVMELLVHLNKRIK      1 - 70
SRPKIQLPVETLLVQYQDPAAVSFVTNFTIIYVKMGYPRLPVEKQCELAPTLLTAMEGKPQPQQDSLMHL     71 - 140
LIPTLFHMKYPVESSKSASPFNLAEKPKTVQLLLDFMLDVLLMPYGYVLNESQSRQNSSSAQGSSSNSGG    141 - 210
GSGIPQPPPGMSFYAAKRVIGDNPWTPEQLEQCKLGIVKFIEAEQVPELEAVLHLVIASSDTRHSVATAA    211 - 280
DLELKSKQSLIDWNNPAIINKMYKVYLGDIPLKTKEGAVLKPELKRDPVSTRVKLKIVPHLLRSRQAAET    281 - 350
FPANIQVVYDGLFGTNTNSKLRTLSLQFVHHICITCPEIKIKPLGPMLLNGLTKLINEYKEDPKLLSMAY    351 - 420
SAVGKLSSRMPHLFTKDIALVQQLFEALCKEEPETRLAIQEALSMMVGAYSTLEGAQRTLMEALVASYLI    421 - 490
KPEVQVRQVAVKFASTVFPSDHIPSRYLLLLAAGDPREEVHGEAQRVLRCLPGRNRKESTSEQMPSFPEM    491 - 560
VYYIQEKASHRMKTPVKYMTGTTVLPFNPAAFGEIVLYLRMCLAHSAGVVPTSQSLADMQDHAPAIGRYI    561 - 630
RTLMSSGQMAPSSSNKSGETNPVQIYIGLLQQLLAGVGGLPVMYCLLEAVSVYPEKLATKFVDKTEWIKS    631 - 700
LMNNSKEEMRELAALFYSVVVSTVSGNELKSMIEQLIKTTKDNHSPEIQHGSLLALGFTVGRYLAKKKMR    701 - 770
MSEQQDLERNADTLPDQEELIQSATETIGSFLDSTSPLLAIAACTALGEIGRNGPLPIPSEGSGFTKLHL    771 - 840
VESLLSRIPSSKETNKMKERAIQTLGYFPVGDGDFPHQKLLLQGLMDSVEAKQIELQFTIGEAITSAAIG    841 - 910
TSSVAARDAWQMTEEEYTPPAGAKVNDVVPWVLDVILNKHIISPNPHVRQAACIWLLSLVRKLSTHKEVK    911 - 980
SHLKEIQSAFVSVLSENDELSQDVASKGLGLVYELGNEQDQQELVSTLVETLMTGKRVKHEVSGETVVFQ    981 - 1050
GGALGKTPDGQGLSTYKELCSLASDLSQPDLVYKFMNLANHHAMWNSRKGAAFGFNVIATRAGEQLAPFL   1051 - 1120
PQLVPRLYRYQFDPNLGIRQAMTSIWNALVTDKSMVDKYLKEILQDLVKNLTSNMWRVRESSCLALNDLL   1121 - 1190
RGRPLDDIIDKLPEIWETLFRVQDDIKESVRKAAELALKTLSKVCVKMCDPAKGAAGQRTIAALLPCLLD   1191 - 1260
KGMMSTVTEVRALSINTLVKISKSAGAMLKPHAPKLIPALLESLSVLEPQVLNYLSLRATEQEKAAMDSA   1261 - 1330
RLSAAKSSPMMETINMCLQYLDVSVLGELVPRLCELIRSGVGLGTKGGCASVIVSLTTQCPQDLTPYSGK   1331 - 1400
LMSALLSGLTDRNSVIQKSCAFAMGHLVRTSRDSSTEKLLQKLNGWYMEKEEPIYKTSCALTIHAIGRYS   1401 - 1470
PDVLKNHAKEVLPLAFLGMHEIADEEKSEKEECNLWTEVWQENVPGSFGGIRLYLQELITITQKALQSQS   1471 - 1540
WKMKAQGAIAMASIAKQTSSLVPPYLGMILTALLQGLAGRTWAGKEELLKAIACVVTACSAELEKSVPNQ   1541 - 1610
PSTNEILQAVLKECSKENVKYKIVAISCAADILKATKEDRFQEFSNIVIPLIKKNSLESSGVRTTKNEEE   1611 - 1680
NEKEKELQLEYLLGAFESLGKAWPRNAETQRCYRQELCKLMCERLKLSTWKVQLGVLQSMNAFFQGLMLL   1681 - 1750
EEEHADPEALAEILLETCKSITYSLENKTYSSVRTEALSVIELLLKKLEESKQWECLTSECRVLLIESLA   1751 - 1820
TMEPDSRPELQEKAALLKKTLENLE                                                1821 - 1845
//

Text Mined References (23)

PMID Year Title