Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.31
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1187 9.5e-11
ovarian cancer 8520 6.4e-08
dermatomyositis 966 1.1e-03
osteosarcoma 7950 1.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
ENSP00000256078 30 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
dermatomyositis 1.500 1.1e-03
juvenile dermatomyositis 1.003 9.5e-11
osteosarcoma -1.433 1.7e-03
ovarian cancer -1.700 6.4e-08

Gene RIF (1)

AA Sequence

MYCCSAQDSKMDYKRRFLLGGSKQKVQQHQQYPMPELGRALSAPLASTATTAPLGSLTAAGSCHHAMPHT      1 - 70
TPIADIQQGISKYLDALNVFCRASTFLTDLFSTVFRNSHYSKAATQLKDVQEHVMEAASRLTSAIKPEIA     71 - 140
KMLMELSAGAANFTDQKEFSLQDIEVLGRCFLTVVQVHFQFLTHALQKVQPVAHSCFAEVIVPEKKNSGS    141 - 210
GGGLSGMGHTPEVEEAVRSWRGAAEATSRLRERGCDGCLAGIEVQQLFCSQSAAIPEHQLKELNIKIDSA    211 - 280
LQAYKIALESLGHCEYAMKAGFHLNPKAIEASLQGCCSEAEAQQTGRRQTPPQPMQCELPTVPVQIGSHF    281 - 350
LKGVSFNESAADNLKLKTHTMLQLMKEAGCYNGITSRDDFPVTEVLNQVCPSTWRGACKTAVQLLFGQAG    351 - 420
LVVVDTAQIENKEAYAPQISLEGSRIVVQVPSTWCLKEDPATMSLLQRSLDPEKTLGLVDVLYTAVLDLN    421 - 490
RWRAGREQALPCIQIQLQREICDFGNQADLPSGNGNKSSGGLQKTFSKLTSRFTKKASCTSSSSSTNYSI    491 - 560
QNTPSKNIFIAGCSEEKAKMPGNIDTRLQSILNIGNFPRTTDPSQSAQNSSNTVANGFLMERRENFLHGD    561 - 630
DGKDEKGMNLPTDQEMQEVIDFLSGFNMGQSHQGSPLVTRHNSAATAMVTEQKAGAMQPQQPSLPVPPPP    631 - 700
RAPQAGAHTPLTPQPGLAPQQQSPKQQQPQVQYYQHLLQPIGPQQPPPQPRAPGKWVHGSSQQPAQAVGA    701 - 770
GLSPLGQWPGISDLSSDLYSLGLVSSYMDNVMSEVLGQKPQGPRNNTWPNRDQSDGVFGMLGEILPFDPA    771 - 840
VGSDPEFARYVAGVSQAMQQKRQAQHGRRPGNPRGNWPPMDDAHRTWPFPEFFTEGDGLHGGWSGAQGDS    841 - 910
ASSSDETSSANGDSLFSMFSGPDLVAAVKQRRKHSSGEQDTSTLPSPPLLTTVEDVNQDNKTKTWPPKAP    911 - 980
WQHPSPLPSTLPSPSAPLYAVTSPGSQWNDTMQMLQSPVWAATNDCSAAAFSYVQTPPQPPPPPAHKAAP    981 - 1050
KGFKAFPGKGERRPAYLPQY                                                     1051 - 1070
//

Text Mined References (9)

PMID Year Title