Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 3.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
hepatocellular carcinoma 1.200 8.7e-06
pancreatic cancer 1.100 4.8e-03
psoriasis -1.500 1.4e-04
osteosarcoma -1.587 1.8e-02
glioblastoma 1.500 1.6e-02
tuberculosis 1.100 4.5e-04
non-small cell lung cancer -1.440 1.5e-18
lung cancer -2.600 1.0e-05
diabetes mellitus -2.300 1.1e-02
adult high grade glioma 1.500 1.7e-04
pilocytic astrocytoma 1.900 3.1e-06
pancreatic carcinoma 1.100 4.8e-03
ovarian cancer 1.400 2.0e-08

Gene RIF (2)

PMID Text
21956439 conclude that KIAA0040 might harbor a causal variant for AD and thus might directly contribute to risk for this disorder.
21703634 Several flanking SNPs of the top hits in the meta-analysis demonstrated borderline associations with alcohol dependence in the family sample for KIAA0040, NRD1 and THSD7B, respectively.

AA Sequence

MHYVHVHRVTTQPRNKPQTKCPSGGQSQGPRGQFLDTVLAAMCPIAMLLTADPGMPPTCLWHTPHAKHKE      1 - 70
HLSIHLNMVPKCVHMHVTHTHTNSGSRYVGKYILLIKWSLAMYFVQGSTLSTVTKMSHGKALPDSDTYIQ     71 - 140
FPNQQGPHTPSIP                                                             141 - 153
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24829844 2013 Family-based association analysis of alcohol dependence implicates KIAA0040 on Chromosome 1q in multiplex alcohol dependence families.
21956439 2012 Genome-wide association study of alcohol dependence implicates KIAA0040 on chromosome 1q.
21703634 2011 A meta-analysis of two genome-wide association studies identifies 3 new loci for alcohol dependence.
18757439 2008 Tumor-associated galectin-3 modulates the function of tumor-reactive T cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7584028 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1 (supplement).
7584026 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1.