Property Summary

NCBI Gene PubMed Count 735
PubMed Score 4236.06
PubTator Score 2715.46

Knowledge Summary

Patent (506,465)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (16)

Disease log2 FC p
urothelial carcinoma 1.700 2.5e-03
malignant mesothelioma -7.100 3.5e-10
glioblastoma 1.200 1.4e-02
non-small cell lung carcinoma -1.400 1.2e-18
intraductal papillary-mucinous carcinoma... -1.200 1.1e-02
intraductal papillary-mucinous neoplasm ... -1.100 3.9e-02
lung cancer -2.400 1.3e-05
interstitial cystitis 1.200 2.7e-04
cystic fibrosis -1.300 1.7e-02
lung adenocarcinoma -1.300 2.7e-08
posterior fossa group A ependymoma 1.100 2.5e-05
invasive ductal carcinoma -1.100 1.5e-02
ulcerative colitis 1.200 1.2e-03
ovarian cancer -5.400 1.6e-17
chronic rhinosinusitis 1.160 2.1e-02
facioscapulohumeral dystrophy -2.500 1.4e-04

Synonym

Accession P35968 A2RRS0 B5A925 C5IFA0 O60723 Q14178 VEGFR-2
Symbols FLK1
CD309
VEGFR
VEGFR2

Gene

KDR

PDB

3V2A   2X1W   2X1X   1VR2   1Y6A   1Y6B   1YWN   2M59   2MET   2MEU   2OH4   2P2H   2P2I   2QU5   2QU6   2RL5   2XIR   3B8Q   3B8R   3BE2   3C7Q   3CJF   3CJG   3CP9   3CPB   3CPC   3DTW   3EFL   3EWH   3KVQ   3S35   3S36   3S37   3U6J   3V6B   3VHE   3VHK   3VID   3VNT   3VO3   3WZD   3WZE   4AG8   4AGC   4AGD   4ASD   4ASE   5EW3  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (693)

PMID Text
26981634 Meta-analysis. Our finding indicates that VEGFR polymorphism +1192C>T and +1719A>T may be associated with the risk of stroke, but not -604T>C.
26890264 increased expression of VEGF-A and VEGFR-2 mRNA in neointima compared to normal aorta; a significantly higher protein content of VEGF-A and VEGFR-2 in neointima samples compared to controls was also observed; results indicate possible involvement of VEGF-A and VEGFR-2 system in the pathologic process of neointima formation after vascular interventions
26879375 Hydrogen sulfide promotes angiogenesis by downregulating miR-640 and increasing the levels of HIF1A through the VEGFR2-mTOR pathway.
26853422 Results suggest, a potential role for PIK3CA, VEGFR2, RET and FGFR2 as therapeutic targets in EGFR non-mutated NSCLC that requires further clinical validation.
26735859 Report KDR genetic alterations in angiosarcomas.
26709129 Negative for VEGF/VEGFR2.
26655705 TLR4 knockdown inhibited VEGF signaling through VEGF receptor 2 (VEGFR2).
26653034 IL-8 rs4073 and VEGFR-2 rs2071559 genotypes may represent important molecular determinants to modulate final outcomes in neovascular age-related macular degeneration patients.
26627848 High expression of VEGFR2 is associated with astrocytomas.
26600539 KDR siRNA can significantly silence KDR gene and protein expression in A549 cells, inhibit the proliferation of A549 cells, and enhance their sensitivity to docetaxel
26600200 findings suggest that the VEGFR2 gene -604T>C polymorphism and TAC haplotype are associated with deep venous thrombosis (DVT), and the TAC haplotype might affect the efficacy of long-term treatment of DVT patients
26577922 uPAR-VEGFR2 interaction is crucial for VEGF signaling in endothelial cells
26541778 This study provides initial evidence that (64)Cu-NOTA-RamAb can function as a PET imaging agent for visualizing VEGFR-2 expression in vivo
26510548 VEGFR2, the main target of VEGFA-induced angiogenesis, was underexpressed in BA, and VEGFA was decreased in most BA patients.
26476544 Our findings suggest a strong association between the VEGFA and VEGFR2 polymorphisms and adverse clinico-pathological parameters in chronic myeloid leukemia, also found significant genotype interactions in VEGFA and VEGFR2 genes in elevated risk for chronic myeloid leukemia susceptibility.
26459253 blocking the expression of VEGFR2 inhibited proliferation, migration, and invasion in the non-small cell lung cancer cell line Calu-1
26375674 Findings suggest that VEGF(R)-inhibition may improve the efficacy of intraperitoneal chemotherapy (IPC), particularly for patients for whom a complete cytoreduction might not be feasible.
26345385 miR-497 inhibits tumor angiogenesis and growth via targeting VEGFR2, indicating miR-497 can be explored as a potential drug candidate for cancer therapy.
26337470 The genetic statistical interaction between VEGFR-2 (rs2071559, rs11133360) and P2X7R (rs3751143, rs208294) genotypes may identify a population of prostate cancer patients with a better prognosis.
26325365 Data suggest that targeting endothelial growth factor receptor 2 (VEGFR-2/KDR) with TTAC-0001 could be a promising approach for cancer treatment.
26298629 High expression of VEGFR2 (KDR) is significantly associated with decreased patients' survival
26268996 This large study highlights the prognostic importance of VEGF-A and VEGFR-2 stromal expression in prostate cancer.
26259755 High VEGFR2 expression is associated with Gastric Adenocarcinoma.
26254223 Suggest curcumin as a inhibitor of VEGF-VEGFR2 signaling pathway in endothelial cells to prevent tumor growth.
26211596 Patients with clear cell renal cell carcinoma were associated with high levels of VEGFR-2 protein expression.
26199386 The properties of VEGFR2 and c-telopeptide collagen observed in this study inform the design of future combination antiangiogenic therapy trials.
26191229 High VEGF plus VEGFR expression and AKT phosphorylation are highest in leukocytes of remission patients, suggesting VEGF signaling as a cause of reduced apoptosis susceptibility upon treatments.
26174951 inhibitory effect of RSV on the HIF-1alpha/VEGF/VEGFR2 signaling axis is mediated, at least in part, through SIRT1
26169036 Sorafenib controls the growth of endometriotic lesions in vitro and in vivo by inhibiting MAPK/VEGFR signaling.
26137585 MET suppresses VEGFR2 protein by inducing its endoplasmic-reticulum-associated degradation (ERAD), via intracrine VEGF action.
26126033 VEGF and VEGFR2 and angiogenic activity are present in dental follicles and dentigerous cysts and may contribute to local bone resorption for tooth eruption or the development and progression of dentigerous cysts
26080815 mutant p53 impacts transcription of VEGFR2 as well as myriad other genes by promoter remodeling through interaction with and likely regulation of the SWI/SNF chromatin remodeling complex
26059764 The data provide new insights for the chaperone function of PDCL3 in angiogenesis and the roles of hypoxia and N-terminal methionine acetylation in PDCL3 expression and its effect on VEGFR-2.
26028346 The CATT and IVAN data do not support a pharmacogenetic association between the 2 VEGFR2 SNPs, rs4576072 and rs6828477, and change in VA in response to anti-VEGF therapy in patients with neovascular AMD.
26021863 Our findings demonstrate for the first time that CHIP may be involved in RCC angiogenesis through regulating VEGF secretion and expression of VEGFR2.
26021484 Thus, (131)I-anti-VEGFR2 cFab has the potential to be used for molecularly targeted treatment of hepatocellular carcinoma overexpressing VEGFR2.
26014518 We found that expression of Gab1, VEGFR-2, and MMP-9 was highly and positively correlated with each other and with lymph node metastasis and TNM stage in intrahepatic cholangiocarcinoma tissues
25986862 data demonstrates that PTK7 regulates the activity of KDR biphasically by inducing oligomerization of KDR molecules at lower concentrations and by surrounding KDR molecules at higher concentrations.
25979342 Heparin influences VEGF receptor-1, VEGF receptor-2, and neuropilin-1 through distinct mechanisms and regulates VEGF-induced signaling.
25978354 CA down-regulates the VEGFR2/Src/FAK/cdc42 axis.
25976977 VEGFR-2 expression correlated positively with lymph node (LN) metastasis of breast cancer
25971967 TRPC1 functions as a major regulator of S1P3 and VEGFR2 expression.
25970161 study found VEGFR2 correlates with the clinical severity of dengue and muscle dysfunction
25967108 The VEGFR-2 activating pathway is closely involved in tumor cell-associated, vessel-mediated and immuno-inflammatory processes in colon carcinoma
25948043 PEDF binds VEGFR-1 and VEGFR-2 in vascular endothelial cells.
25909285 Data indicate that foretinib suppresses angiogenesis and lymphangiogenesis by blocking vascular endothelial growth factor receptors VEGFR-2/3 and TIE-2 receptor signaling.
25896473 Results support a CTLA4-Ig/CD86 interaction on gammaIFN and IL-17 activated endothelial cells that modulates the expression of VEGFR-2 and ICAM1.
25895461 Our findings indicate that activation of VEGFR1 and VEGFR2 in epithelial and inflammatory cells appears to be an early event in lip carcinogenesis.
25883000 findings show that VEGF-R overexpression occurs frequently in OSCC and could have clinical implications
25878330 Significant and consistent inhibition of the VEGF pathway (using VEGFR2 as the readout) was observed in granulation tissue biopsies from patients treated with bevacizumab and everolimus.
25872462 Data suggest that plasma levels of VEGFR2 are down-regulated in patients with type 2 diabetes mellitus as compared to control subjects.
25825981 CD147 is a novel coreceptor of VEGFR-2 with a role in mediating its activation by VEGF
25810250 Gremlin/VEGFR2 axis participates in renal inflammation and could be a novel target for kidney disease.
25787923 Ramucirumab, a human immunoglobulin G1 monoclonal antibody targeting the vascular endothelial growth factor receptor-2, was well tolerated in patients with advanced solid tumors.
25775978 Data show that prohaptoglobin promotes angiogenesis via vascular endothelial growth factor (VEGF) and VEGF receptor2 signalling.
25756047 There were no significant correlations between VEGF, sVEGF-R1, sVEGF-R2, and platelet counts in chronic urticaria and the healthy subjects
25754303 a novel pathway wherein heparanse sequentially activates integrin beta1, HIF-2alpha, Flk-1, and p38MAPK/HSP27 with corresponding enhancement of angiogenesis
25713439 Studies indicate that patients most likely to benefit from anti-vascular endothelial growth factor and anti-vascular endothelial growth factor receptor (anti-VEGF/anti-VEGFR) therapy.
25707392 The gene-gene interactions identified in the survival tree analysis support the importance of VEGFR2 rs2071559 and KISS1 rs71745629 in modulating these outcomes.
25698653 Vascular endothelial growth factor receptor 2 (VEGFR2) interacted with peptide Lv.
25682871 Glioma cell VEGFR-2 confers resistance to chemotherapeutic and antiangiogenic treatments in PTEN-deficient glioblastoma.
25569182 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
25560472 This review presents an update on the potential role of VEGF and VEGF receptor-2 SNPs as prognostic and/or predictive markers in patients with breast cancer.
25550804 cytoplasmic expression of VEGF, VEGFR2, PDGF-B, and PDGFR-beta in RCC tumour cells is different in various pathologic stage and cell type. Notably, VEGF and PDGF-B expression are higher in papillary than in clear cell renal cell carcinoma.
25521758 results demonstrate that Mixl1 and Flk1 play roles...during dimethyl sulfoxide-induced mesodermal specification in P19 cells.
25521357 The pharmacogenetic statistical interaction between VEGFR-2 rs11133360 and IL-8 rs4073 genotypes may identify a population of patients with a better outcome.
25501707 AKT3, PI3KCA, and VEGFR2 silencing reduces the invasiveness of glioblastoma multiforme T98G cells.
25488616 There was no significant association between VEGFR2 polymorphisms and susceptibility to chronic lymphocytic leukemia.
25471788 Further conclusion showed that Prdx2 regulates VM formation by targeting VEGFR2 activation, which now represents as a therapeutic target for RC.
25441661 results of the current study suggest that expression of MMP9 and VEGFR2 is associated with epithelial dysplasia grading.
25411163 Rs34231037 is associated with serum VEGFR2 response to pazopanib.
25399804 the best characterized of these signaling pathways, that involving the vascular endothelial growth factor (VEGF) family members VEGF-C and VEGF-D, together with their receptors VEGFR2 and VEGFR3.
25387128 N-terminal cleavage and release of the ectodomain of Flt1 is mediated via ADAM10 and ADAM 17 and regulated by VEGFR2 and the Flt1 intracellular domain.
25378411 PAI-1 inhibits activation of VEGFR-2 by VEGF by disrupting a vitronectin-dependent proangiogenic binding interaction involving alphaVbeta3 and VEGFR-2.
25372416 early stage colorectal adenocarcinomas with highly activated (phosphorylated) VEGFR-2 expression may indicate the significance of neoangiogenesis of the tumors.
25354586 VEGFR2 is phosphorylated in a process involving carbon monoxide inhibition of sprouting angiogenesis
25353068 Our results demonstrated that a significantly higher amount of sunitinib could be delivered to the U87MG tumor by targeting VEGFR when compared with the non-targeted counterparts.
25340839 VEGFR family members are expressed in leiomyosarcomas in vivo and in vitro. Upon receptor stimulation, PTK787 is able to inhibit subsequent phosphorylation events and influences cell survival but not metabolic activity and migration
25331892 These results demonstrate that a VEGFR2/NAADP/TPC2/Ca(2+) signaling pathway is critical for VEGF-induced angiogenesis
25329517 The results show that VEGFR1-VEGFR2 levels are more closely coupled than VEGFR1-VEGFR3 or VEGFR2-VEGFR3 in HUVEC and MEC.
25322777 These data demonstrate that ethanol activates Flk-1 and Flt-1 receptors in vascular endothelial cells and promotes angiogenic activity via an Flk-1/notch pathway.
25293577 there is HER2 and EGFR, but not VEGFR expression in micropapillary urothelial carcinoma with invasive urothelial carcinoma
25269419 These results demonstrate the fully human VEGFR2 monoclonal antibody BC001 can work as an effective inhibitor of tumor angiogenesis and tumor growth both in vitro and in vivo
25261665 KDR gene plays a certain role in promotion of human prostate cancer PC-3 cells' proliferation
25245329 Our results indicate that reduced expression of the nuclear long noncoding RNA NEAT1 may play a role in the myeloid differentiation of APL cells.
25217984 high levels of miRNA-185 in RCC are associated with high VEGFR-2 mRNA and protein levels and a higher density of microvessels.
25217645 GPR126 modulates both physiological and pathological angiogenesis through VEGF signaling
25192841 VEGF and VEGFR2 expression were increased after low level laser therapy in human adipocyte-derived mesenchymal stem cells.
25182707 Our results suggest that SNPs in KDR gene can predict clinical outcome in advanced HCC patients receiving first-line sorafenib.
25182240 KDR gene knockdown induces apoptosis in human MCF-7 breast cancer cells .
25147336 NDPKB is required for VEGF-induced angiogenesis and contributes to the correct localization of VEGF receptor type 2 and VE-cadherin at the endothelial adherens junctions.
25128838 The present study demonstrates that the CC genotype of the KDR -604T>C polymorphism (rs2071559) is a possible risk factor for MI in Caucasians with T2DM.
25128562 KIF13B is an essential molecular motor required for the trafficking of VEGFR2 from the Golgi, and its delivery to the endothelial cell surface mediates angiogenesis.
25123269 Single-nucleotide polymorphisms of KDR are associated with response to therapy in hepatocellular carcinoma.
25114179 the carboxy terminal domain inhibits VEGFR-2 activity in the absence of ligand
25111568 KDR rs2071559 GA genotype was significantly over-represented in the female controls
25111127 Suggest dioscin as a potential anticancer drug, which efficiently inhibits angiogenesis induced by endothelial cell VEGFR2 signaling pathway as well as AKT/MAPK pathways.
25025175 the proteins c-KIT, VEGFR2 and PDGFRalpha, encoded by genes at 4q12, are associated to the St Gallen breast cancer subgroup TNBC. No correlation was seen between high protein expression, increased gene copy number and BCM in the TNBC group.
24982127 PTP1b is a key regulator of endothelial VEGFR2 signaling and plays an important role in regulation of the extent of vascular tree formation.
24952732 Data show that doxazosin inhibited the phosphorylation of VEGF receptor-2 (VEGFR-2) Akt and mammalian target of rapamycin (mTOR), and hypoxia-inducible factor 1 (HIF-1alpha) expression.
24952635 Results show that thioridazine regulates endothelial cell function and subsequent angiogenesis by inhibiting VEGFR-2/PI3K/mTOR signal transduction.
24903995 The concentrations of VEGF-A and its receptors 1 and 2 in patients with well-controlled diabetes are comparable to those of healthy individuals, which may indicate that appropriate control of glucose levels delays occurrence of vascular complications.
24886133 genetic association studies in population in Washington DC: Data suggest that SNPs in KDR (rs2305948, rs1870378, rs2305945) are associated with ovarian hyperstimulation syndrome (in women undergoing ovulation induction).
24880751 Cerebrospinal fluid from amyotrophic lateral sclerosis patients caused significant down-regulation of VEGFR2.
24845798 The expressions of VEGF-A, VEGFR2 and VEGFR3 were studied in by immunohistochemistry in 76 endometrial carcinoma specimens. VEGFR2 and VEGFR3 receptor expression were also studied by qRT-PCR in 17 tumors in comparison to normal endometrium.
24738074 in B1647 leukemia cells, VEGFR-2 is present in caveolae through association with Cav-1, demonstrating that caveolae/lipid rafts act as platforms for negative modulation of VEGF redox signal transduction cascades
24713547 In primary ovarian cancer tissue, VEGFR2 expression, detected with an frequency of 18%, was mostly located in the vascular wall and across the stroma.
24687381 An excess of VEGFR2 -604TT genotype was seen in multiple myeloma patients with stage II or III tumors when compared with those with stage I tumors.
24675699 VEGF-A, VEGFR-1, and VEGFR-2 were shown to be up-regulated in malignant Pheochromocytoma, suggesting that these molecules might be considered as therapeutic targets for unresectable or metastatic tumors.
24667918 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
24652518 no pharmacogenetic associations exist between the studied VEGFA and VEGFR2 SNPs and response to anti-VEGF therapy.
24641672 Activation of FLK1-neuropilin-1 signaling in the lung leads to inhibition of epithelial cell apoptosis.
24633336 p53, human telomerase reverse transcriptase, Wilms tumor-1, and vascular endothelial growth factor receptor 2, could induce specific cytotoxic T lymphocytes that showed cytotoxicity against pancreatic cancer cell lines.
24620033 post-translational modification by acetylation is a critical mechanism that directly affects VEGFR2 function.
24585635 ERK3 regulates endothelial cell migration, proliferation and tube formation by upregulating SRC-3/SP-1-mediated VEGFR2 expression.
24568071 associations and gene-diet interactions involving vascular endothelial growth factor receptor-2 gene polymorphisms and fruit diet on uric acid provide new information on gout and hyperuricaemia risks in Malays
24522370 Polymorphisms of VEGF A seem to influence the different response to antiangiogenic treatment in patients with age-related macular degeneration in our population.
24521356 Low gene expression contributes to dysfunctional mobilization of bone marrow cells from VEGF-R2 transgenic mice.
24508097 There is evidence of increased placental angiogenesis in late-onset pre-eclampsia and early-onset pre-eclampsia that is associated with differential activation of VEGFR2.
24442426 High VEGFR2 expression is associated with worse treatment response in hepatocellular carcinoma.
24409324 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
24385342 Hyperglycaemia in Type 1 diabetes mellitus impairs VEGFR2 protein expression in ischaemic hind limbs
24365177 Polymorphisms in the VEGFR2/KDR gene significantly influence visual outcome in patients receiving ranibizumab treatment for neovascular AMD.
24341227 The expression of VEGF and its receptors (VEGFR-1, VEGFR-2 and VEGFR-3) was ascertained to be increased in the placental terminal and stem villi, mostly in type 1 diabetes.
24335081 Identification of a G-rich sequence within the proximal promoter region of vegfr-2 that is able to form an antiparallel G-quadruplex structure.
24303885 decreased expression of VEGFR1 in decidua and weaker VEGF and VEGFR2 expression in placental villi and decidua may be associated with early pregnancy loss.
24300896 methylation of Lys(1041) promotes the activation of VEGFR-2 and that similar posttranslational modification could also regulate the activity of other receptor tyrosine kinases.
24296159 VEGF165 / VEGFR-2 have roles beyond angiogenesis in hair follicle regulation
24260556 sFlt-1, which is known to be increased in hypoxic conditions and pre-eclampsia, directly attenuates VEGFR-2 expression and signaling.
24184958 Probe F2 was capable of enriching all members of the FGF receptor family as well as other kinases involved in cancer such as KDR, FLT4 and RET from lysates of cancer cells or human placenta tissue.
24170768 The possibility to express an angiogenesis regulator as sVEGFR2, in a hypoxia-conditioned manner, significantly opens new strategies for tumor vessel-controlled normalization and the design of adjuvants for combined cancer therapies.
24123039 Single nucleotide polymorphisms in KDR are associated with treatment failure in sunitinib treated gastric and biliary tract cancer patients.
24120473 Neoplastic and non-neoplastic Barrett's epithelial cells have autocrine VEGF signaling. In neoplastic Barrett's cells, VEGF activation of VEGFR2 initiates a PLCG1-protein kinase C-ERK pathway that promotes proliferation.
23990986 Data indicate differential patterns of gene amplification and expression of receptor tyrosine kinases PDGFRA, KIT, and VEGFR2 at the 4q12 locus to be associated with specific phenotypes.
23979202 We have identified the baseline VEGF/sVEGFR-2 and VEGF/TSP-1 ratios as potential biomarkers of response in ABCP treated metronomically with Cy+Cel. This finding warrants its confirmation in a higher number of patients.
23972086 Soluble VEGFR-2 may be involved in the pathogenesis of macular edema associated with branch retinal vein occlusion.
23971975 Our study shows that VEGFA rs699947 and rs833061 and VEGFR2 rs2071559 polymorphisms do not modify the risk of suffering age related macular degeneration in a Spanish population.
23934537 CD45(-)/CXCR4(+)/FLK-1(+) cells may provide a diagnostic tool to follow cardiac regenerative capacity and potentially serve as a prognostic marker in acute myocardial infarction.
23898208 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
23861747 VEGFR2 rs12505758 variants correlated with progression-free survival.
23831629 VEGF and VEGF receptors 1 and 2 have roles in malignant colonic epithelial cell growth through an autocrine mechanism
23799140 addition of both galectins induced a decrease in the VEGFR1 and VEGFR2 endocytic pools, with a significantly enhanced effect on the VEGFR1 endocytic pool
23794399 Single nucleotide polymorphisms in KDR gene is associated with colorectal cancer risk.
23792958 data provide strong evidence for the role of PDCL3 in angiogenesis and establishes the molecular mechanism by which it regulates VEGFR-2 expression and function.
23772669 VEGF-A, VEGFR-1 and VEGFR-2 were statistically correlated with ramifications of blood vessels. No correlation with patient outcome was observed.
23771478 Neither Lin-positive transgene nor Lin-negative/VEGF-R2-positive cells form tube-like structures when cells are seeded on Matrigel(R) and observed for up to 1 week, whereas human vascular endothelial cells (HUVEC) form tube-like structures after 6 hours.
23759331 Silencing GRP78 not only inhibits tumor, but also decreases the expression of VEGF and VEGFR2 in colon cancer.
23754286 Lactate engaged the PI3K/Akt pathway via ligand-mediated activation of the three receptor tyrosine kinases Axl, Tie2, and VEGF receptor 2.
23749886 VEGFR2 expression was significantly higher in muscle invasive bladder cancer than that non-muscle invasive bladder cancer which suggests VEGFR2 expression increases with tumor invasion; results suggest that alterations in expression of VEGF and VEGF receptors are associated with disease stage and recurrence
23746980 The KDR is a conserved marker for endoderm-derived hepatic progenitors and a functional receptor instructing early liver development.
23723256 These results document a physiological role of AR in sex-independent angiogenic potency and provide evidence of novel cross-talk between the androgen/AR signaling and VEGF/kinase insert domain protein receptor signaling pathways.
23709605 Novel nonproteolytic signaling pathway initiated by single chain urokinase and mediated by domain 2 of uPAR, beta1-integrins, and VEGF receptor 2 leads to angiogenesis.
23708980 Mitochondrial UQCRB regulates VEGFR2 signaling in endothelial cells.
23697367 Data indicate that three miRs (miR-484, -642, and -217) were able to predict chemoresistance and vasculature of serous epithelial ovarian carcinomas through the regulation of the VEGFB and VEGFR2 pathways
23688497 Diminishing expression of endogenous microRNA-15b increases VEGFR-2 expression in HUVECs.
23685409 the results demonstrate that NRP-1 is involved in melanoma progression through VEGFR-2-dependent and -independent mechanisms and suggest NRP-1 as a target for the treatment of the metastatic disease.
23684887 decursin may be a potent anti-angiogenic and anti-proliferative agent targeting the VEGFR-2 signaling pathway, which significantly inhibits diabetic retinal neovascularization.
23636508 VEGFR2 receptor is capable of synthesising dinucleoside polyphosphates.
23635398 The results suggested that the 1192C/T polymorphisms on the VEGFR-2 gene might affect the risk of developing endometriosis in Northern Chinese women of Han ethnicity.
23624620 Primary cutaneous large B-cell lymphomas were characterized by significantly higher intratumoral expression levels of VEGF and its receptors in comparison with the indolent lymphoma subtypes.
23620752 The mRNA expressions of the proangiogenic growth factors VEGF, PDGF, bFGF and their receptors (VEGFR1, VEGFR2, PDGFRA, PDGFRB, FGFR1, FGFR2) were measured and compared in gastric ulcers of cirrhotic patients.
23609797 These studies reveal mechanical stretch as a potent agonist for endothelial exocytosis, which is modulated by VEGFR2 signaling.
23583911 Data indicate that the VEGFR-2 inhibitory activities in most of the designed molecules were predicted to be in the 0.01-0.1 muM range.
23555666 Mineralocorticoid receptor activation attenuates the expression of the VEGF receptor 2/KDR, possibly dampening the activation of a VEGFA/KDR dependent signaling pathway important for the survival of tumor cells under hypoxic conditions.
23551429 None of the five VEGF and VEGFR-2 gene polymorphisms investigated in this study was found to be an independent prognostic marker for Korean patients with surgically resected GIST.
23548264 our findings indicate the therapeutic potential of targeting both c-Met and VEGFRs simultaneously with a single small-molecule inhibitor for the treatment of human cancers
23536763 Our study demonstrates VEGFR-2 as an essential molecule to sustain the "stemness" of GSLCs, their capacity to initiate tumor vasculature, and direct initiation of tumor.
23533349 VEGF promotes glioblastoma multiforme cells proliferation through VEGFR2 but not VEGFR1.
23516476 Klotho endows hepatoma cells with resistance to anoikis via VEGFR2/PAK1 activation in hepatocellular carcinoma.
23511629 patients with TT polymorphism of rs833061, CC polymorphism of rs699947, CC polymorphism of rs2010963 and CG polymorphism of rs6877011 seem to have a worse PFS and OS when receiving first-line sunitinib.
23475388 analysis of expression of VEGF and its receptors VEGFR1 and VEGFR2 in primary and recurrent WHO grade III meningiomas
23454747 Tumor cells proliferation reduces in a VEGF/VEGFR2-dependent manner as long as the nutrient supply remains decreased.
23424651 COSMC is a novel regulator for VEGFR2 signaling in endothelial cells and dysregulation of COSMC expression may contribute to the pathogenesis of hemangioma
23418605 Data indicate statistically significant correlations were observed between the number of circulating epithelial tumor cell (CETC) and IGF-IR and VEGFR-2 expression.
23400753 Our data suggest that soluble forms VEGFR2CSF may be more potent than VEGFR1CSF in predicting the outcome of leukemia patients
23393387 TXNIP is essential for VEGFR2 internalization in Rab5 positive endosomes, which is required for endothelial cell growth and angiogenesis.
23393131 Endothelial cell-specific chemotaxis receptor (ECSCR) enhances vascular endothelial growth factor (VEGF) receptor-2/kinase insert domain receptor (KDR) activation and promotes proteolysis of internalized KDR.
23392734 altered expression of esVEGFR-2 is correlated with progression of esophageal squamous cell carcinoma
23376830 3 days after hindlimb ischemia, VEGFR2 surface levels were decreased by 80% compared with endothelial cells from the nonischemic limb.
23376569 The results suggest that VEGF may play a key role through VEGFR-2 in the pathogenesis of pterygium.
23374253 Endorepellin binds through its proximal LG1/2 domains to VEGFR2 and inhibit VEGFA-dependent endothelial migration.
23370473 A significant correlation exists between CTP measures and EGFR overexpression in head and neck squamous cell carcinomas, suggesting an association between certain imaging findings and molecular biomarkers.
23363445 NCTD specifically abrogated the phosphorylation/activation of vascular endothelial growth factor receptor-2.
23348691 Brucine potently suppresses angiogenesis by targeting VEGFR2 activation and may be a viable drug candidate in anti-angiogenesis and anti-cancer therapies.
23341459 VEGFR2 internalization may be a generic requirement for pro-angiogenic growth factors to activate endothelial ERK1/2 signaling
23331867 IGF1R coupled with Sdc1 is required for activation of the alphaVbeta3 integrin and for VEGFR2 signalling.
23293110 VEGFR-2 and PAR-1 polymorphisms predicted longer disease-free survival and overall survival in pancreatic carcinoma. CXCR-2 polymorphism was a negative predictor for disease-free survival.
23273598 angiotensin through AT1-R modulates KDR expression and have influence on local VEGF level.
23262137 This is the first report demonstrating that Myo1c is an important mediator of VEGF-induced VEGFR2 delivery to the cell surface and plays a role in angiogenic signaling.
23258273 miR-17-3p is a negative regulator of the angiogenic phenotype of endothelial cells through its ability to modulate the expression of Flk-1, which is implicated in the pleiotropic effects of miR-17-92 in angiogenesis.
23254951 Downregulation of VEGF-A and VEGFR-2 expression mediated by Jiedu Xiaozheng Yin, a Chinese herbal formula, inhibits tumor angiogenesis.
23250775 VEGF, VEGF-R1 and VEGF-R2 are over-expressed in tumour epithelial cells in oesophagogastric cancer.
23221067 VEGF and VEGFR-2 was detected in macrophages and endothelia of abnormal vessels in eyes with Coats' disease.
23202541 Results suggest that FOXP3(+)VEGFR2(+) may be a better predictive Treg cells marker than FOXP3(+) alone for recurrence and survival in patients with colorectal cancer.
23174599 Ang-2, Tie-2 and VEGFR-2 are involved in the development, invasion, metastasis, and prognosis of colorectal cancer, and play important roles in angiogenesis.
23172303 Data suggest that signaling via VEGFA-VEGFR1/FLT1 and VEGFA-VEGFR2/FLK1 plays central roles in regulation of angiogenesis and lymphangiogenesis; VEGFA-VEGFR/FLT1 and VEGFA-VEGFR2/FLK1 signaling is crucial for tumour angiogenesis. [REVIEW]
23171577 [review] Binding ability of in vitro cultured CD34+/KDR+ cells capable of homing to sites of neovascularization suggests that this pair of antigens serves to characterize circulating endothelial progenitor cells.
23169005 KDR polymorphism is associated with colorectal cancer.
23158831 An association between the KDR -604T-->C polymorphism and recurrent spontaneous abortion was found in Korean women.
23155052 MMP-1 promotes VEGFR2 expression and proliferation of endothelial cells through stimulation of PAR-1 and activation of NF-kappaB
23151382 By augmenting VEGFR2 expression in the placental amnion, PBEF primes the tissue for a VEGF-mediated increase in permeability.
23146028 VEGFR2, PDGFRalpha and PDGFRbeta mutations were evaluated by sequencing their tyrosine kinase domains.
23139789 Perturbation of the HSP70-HSP90 heat-shock protein axis stimulates degradation of endothelial VEGFR2.
23111153 Although structural data suggest that both VEGFR2 SNPs may contribute to systemic lupus erythematosus pathogenesis by impairing VEGF signalling, none of the SNPs analysed was associated with increased susceptibility to SLE.
23077562 The KDR -604C/1192A/1719T haplotype increased the risk of pediatric moyamoya (p = 0.024).
23060442 Endorepellin affects angiogenesis by antagonizing diverse VEGFR2-evoked signaling pathways: transcriptional repression of hypoxia-inducible factor 1alpha and VEGFA and concurrent inhibition of NFAT1 activation.
23059888 VEGFR-1, VEGFR-2 and VEGFR-3 are expressed in both fetal and adult bone. The gene expression levels were significantly higher in fetal samples especially in mandibles. In addition, higher levels of VEGFR-3 in orofacial district were confirmed.
23038639 Except for VEGFR-2, extensive staining was observed for all VEGF ligands and receptors in the prostate cancer specimens.
23030506 Higher levels of VEGFR2 and frequency of AG (rs1531289) genotype are linked to the pathogenesis of age-related macular degeneration.
22997228 Alternative polyadenylation of exon 30 or intron 13 leads to the production of mbKDR or sKDR, respectively, yet the regulatory mechanisms are unknown
22975327 The functions are mediated by endothelial S1PR1, which in turn regulates the interplay between VE-cadherin and VEGFR2.
22965144 Formation of pial collaterals occurs during a narrow developmental window via a sprouting angiogenesis-like mechanism requiring VEGF stimulation of FLK1.
22956423 Beta(2)-GPI suppresses VEGF-induced phosphorylation of VEGF receptor 2.
22955733 Data show that the increase in FLT1/sFLT1 protein levels upon miR-10 knockdown in umbilical venous endothelial cells inhibited the angiogenic behavior of endothelial cells largely by antagonizing vascular endothelial growth factor receptor 2 signaling.
22828632 The findings indicate that VEGFR-1 subunits modulate VEGF activity predominantly by forming heterodimer receptors with VEGFR-2 subunits and such heterodimers regulate endothelial cell homeostasis.
22789536 demonstrate that vascular endothelial growth factor (VEGF) directly and negatively regulates tumor cell invasion through enhanced recruitment of the protein tyrosine phosphatase 1B (PTP1B) to a MET/VEGFR2 heterocomplex
22772062 Elevated expression of cyclin I and VEGFR-2 is likely to provide a proliferative advantage to the EOC cells, and that cyclin I may be linked with angiogenesis in EOC. Higher expression of VEGFR-2 is associated with more advanced disease.
22763125 This study indentified VEGFR2 as a PTPN9 substrate, and indicated that PTPN9 is a negative regulator of VEGFR2 signaling and function in endothelial cells.
22730813 VEGF/flk-1 participate in the growth of nasal inverted papillomas. Enhanced VEGF/flk-1 in the epithelium may be indicative of malignant transformation.
22723445 Pharmacological activation of endothelial LXRs reduces angiogenesis by restraining cholesterol-dependent vascular endothelial growth factor receptor-2 compartmentation and signaling.
22718841 Data suggest that CD146 interacts with VEGFR-2 in vascular endothelium and promotes angiogenesis; studies include identifying the basis of CD146 binding to VEGFR-2.
22711876 Data show that beta-TRCP knockdown causes accumulation of VEGFR2, resulting in increased activity of signaling pathways downstream of VEGFR2.
22710795 We defined a molecular mechanism by which FAS1 domain protein blocks the association between alpha 5 beta 3 integrin and VEGFR-2
22707264 Data suggest lycopene, a dietary component, inhibits angiogenesis; lycopene appears to down-regulate signal transduction by inhibition of MMP2 (matrix metallopeptidase 2) and uPA (urokinase-type plasminogen activator) via VEGFR2-mediated signaling.
22706170 Characterise KDR-positive endothelial-like progenitor cells.
22690749 VEGF expression was significantly associated with VEGFR-1 and VEGFR-2 in primary breast carcinomas, higher expression of which selects a prognostically unfavourable patient group.
22659165 The VEGFR-2 is expressed on primary human hair follicle DP cells and VEGF induces proliferation of DP cells through VEGFR-2/ERK pathway, but not p38, JNK or AKT signaling.
22654102 Data demonstrate a central role of Flk-1 in the formation of VM in glioblastoma.
22592917 c-Jun N-terminal kinase/stress-activated protein kinase regulates VEGFA-induced VEGFR2 sustained phosphorylation, which plays important roles in VEGFA-induced angiogenesis in human umbilical vein endothelial cells.
22587628 association with ovarian hyperstimulation syndrome not found for VEGFR2 -604 t>c (rs2071559), VEGFR2 +1719 a>t (rs1870377)
22553146 Advanced glycation end product Nepsilon-carboxymethyllysine induces endothelial cell injuryinvolving SHP-1-regulated VEGFR-2 dephosphorylation.
22542663 results demonstrate that the proteolytic enzyme MMP-9 promotes resistant epithelial breast cancer cells migration and tubular network formation through VEGFR-2/ VEGFR-3 activation
22541785 We studied the expression of VEGF protein, VEGF-mRNA, VEGF receptor (VEGFR)-1 mRNA, VEGFR-2 mRNA in patients with recurring meningiomas
22541078 Expression of VEGFR2 in HL-60 cells decreased after treatment with berberine.
22539090 Changes in the proportion of circulating VEGFR2- and pAkt- positive cells may be a potential pharmacodynamic marker of the efficacy of antiangiogenic agents, and could prove valuable in determining drug dosage and administration schedule
22528855 slightly up-regulated in fibroblast-like stromal cells in revision total hip replacement compared to osteoarthritis
22520092 KDR single nucleotide polymorphisms may serve as genetic markers for the increased risk of silent brain infarction among the younger (<65 years) or male only Korean subpopulations.
22510937 results suggest that the kinase insert domain receptor -604C allele may increase the risk of premature ovarian failure development in Korean women
22507619 genetic association studies in Chinese Malaysian and Japanese adults: Data suggest that 2 SNP in VEGFR2 (rs1870377; rs2071559) along with dietary patterns are associated with either decreased or increased risk of cardiovascular diseases.
22473693 Report VEGFR2 expression in embryonic sympathol-adrenal tissues and differentiated neuroblastomas.
22426130 These findings identify a potent antimigratory function of HO-1 in VSMCs, a mechanism that involves VEGFA and VEGFR2 upregulation, followed by assembly of inactive VEGFR2/PDGFRbeta complexes that attenuates effective PDGFRbeta signaling.
22407444 Hantaan virus infection upregulated the expression of beta3 and VEGFR2.
22404826 Single nucleotide polymorphisms in VEGFR2 gene is associated with lymphedema after breast cancer.
22395975 Vascular endothelial growth factor receptor 2 gene polymorphisms is associated with tumor recurrence in non-small-cell lung cancer.
22393126 VEGFR2 is preferentially expressed on the cell surface of the CD133(+) glioma stem-like cells, whose viability, self-renewal, and tumorigenicity rely, at least in part, on signaling through the VEGF-VEGFR2-Neuropilin-1 axis.
22386962 KDR mRNA was reduced in placentae from late pre-term births, from pre-eclamptic pregnancies, and pregnancies complicated by gestational hypertension.
22362758 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
22344734 Paternal and neonatal carriage of the Kinase insert domain receptor KDR-604T/C polymorphism is associated with the risk of preeclampsia and small-for-gestational-age infants
22327338 c-ABL function is to establish a correct and tightly controlled response of endothelial cells to VEGF-A during the angiogenic process.
22314185 VEGFR2 is a promising marker for malignant vascular tumors and malignant epithelioid mesothelioma.
22303475 This study shows that VEGFR2 is involved in the delayed phase of endothelial cell barrier dysfunction caused by high oxidation products of 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphatidylcholine concentrations.
22301682 A dietary pattern of MRND (meat-rice and noodles diet) and VEGFR2 gene polymorphisms were both associated with increased health risks of lifestyle-related chronic diseases particularly blood glucose and lipid levels in Chinese Malaysian adults.
22274884 Our findings suggested that VEGFR-2 gene variants might contribute to glioma susceptibility.
22268049 The concentrations of VEGF and VEGFR2 differed more significantly in primary and recurrent forms of arteriovenous angiodysplasias (as compared to venous angiodysplasias).
22229497 molecular dynamics simulations were used to gain insight into the conformational switching activity of the KDR domain and to identify intermediate conformations between the two limiting active and inactive conformations
22227235 VEGFR inhibition increases iodide uptake and decreases PA production through regulation of p42/44 MAPK phosphorylation.
22208996 Data show the potential of Nanobodies for the blockade of VEGFR2 signaling and provide a basis for the development of novel cancer therapeutics.
22207738 Thermodynamic and structural description of allosterically regulated VEGFR-2 dimerization.
22203933 This study revealed that VEGFR1 and VEGFR2 correlate with tumor localization, tumoral area (front vs. center of the tumor), histological differentiation degree, and lymph node involvement, while only VEGFR1 correlated with stage.
22203927 Immunostaining for VEGF and its R1 and R2 receptors was present both in tumor cells and mast cells.
22199315 IDH1 mutation may correlate with the benefit from VEGF(R)- versus EGFR-targeted therapy at the time of recurrence in glioma patients
22184869 In the early stage of angiogenesis, VEGF-R2 leads to expression of VEGF, and HIF-1 mediates increased VEGF expression in response to hypoxia in swollen tissues or during the expansion of periodontal tissues.
22182247 our findings suggest Single nucleotide polymorphisms in the KDR gene modulate colorectal cancer recurrence, especially in those receiving chemotherapy.
22174934 VEGF-A stimulation of lymphatic endothelial cells leads to the phosphorylation of VEGFR2 (Tyr 951, 1054, 1059, 1175, and 1214) which subsequently triggers PKC dependent phosphorylation of ERK1/2 and PI3-K dependent phosphorylation of Akt.
22170730 study shows that FISH positivity for VEGFR2 and KIT occurs in approximately 30percent of Triple-negative breast cancer (TNBC) and 18percent of non-TNBCs. increased VEGFR2 and KIT copy numbers were corr;lated, probably reflecting co-amplification; no correlation between protein levels and copy number for either VEGFR2 or KIT was observed
22169262 analysis of of 4-aminoquinazoline derivatives targeting VEGFR-2 tyrosine kinase
22159994 Venous smooth muscle cells showed a significant increase in VEGFR-2 expression under hypoxia compared with arterial smooth muscle cells.
22153185 Mutations in the activation loop and juxtamembrane domains of VEGFR-2 is not asssociated with chronic myelomonocytic leukemia.
22129133 The associations of functional polymorphisms in the VEGFA and VEGFR2 with survival were analyzed in patients with diffuse large B cell lymphoma
22099303 a physiological function of PrxII as the residential antioxidant safeguard specific to the redox-sensitive VEGFR2
22095860 KDR attenuated CoCl(2)-induced cell injury in HEK293 cells.
22095559 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
22062947 Data demonstrates for the first time that VEGFR-2 signaling is activated and promotes survival of keratinocytes under moderate dose of UVB irradiation.
22038228 Data suggest that decreased VEGFR-2 expression in the podocyte processes of children with idiopathic nephrotic syndrome might be regarded as a potent factor of unfavorable prognosis.
22025615 itraconazole interferes with VEGFR2 trafficking, glycosylation, and signaling activity
22020326 MMRN2 as a crucial player in the regulation of EC function, neo-angiogenesis and hence tumor growth
22019447 VEGFR2 is critically involved in adhesion molecule induction and monocytic cell recruitment to endothelium in response to non-uniform shear stress and TNF-alpha.
22016416 VEGF-A plays a role in the occurrence of OHSS, and the amount of biologically available VEGF-A is modulated by sVEGF-R1, R2 and R3
22003972 All groups of mice that were treated with anti-hVEGFR2 antibody showed markedly reduced tumor growth.
22002459 role for endothelial ARNO in VEGF-dependent initiation of angiogenesis by regulation of VEGFR-2 internalization in endothelial cells, resulting in the activation of the Akt pathway, vessel permeability, and ultimately endothelial proliferation
21985798 vascular phenotype with regard to VEGFR2 expression and TGF-beta signaling in endothelial cells varies with malignancy in human glioma.
21984395 In univariate analysis high pVEGFR2/KDR receptor expression was significantly related with poor prognosis
21980525 a new mechanism by which VEGFR2 activates its own promoter that could be involved in amplifying the angiogenic response
21937609 PI3 kinase-alpha/gamma-mediated signaling downstream of VEGFR2 activation regulated Akt-dependent survival signals, but it was not required to activate endothelial nitric oxide synthase or to elicit NO production in glomerular endothelial cells.
21909756 KDR protein was presented in the cell plasma membrane of human internal tissues.
21893193 We found binding programmed cell death 6 to vascular endothelial growth factor receptor 2, a key player in the PI3K/mTOR/P70S6K signaling pathway
21885851 MicroRNA-16 and microRNA-424 regulate cell-autonomous angiogenic functions in endothelial cells via targeting vascular endothelial growth factor receptor-2 and fibroblast growth factor receptor-1.
21882181 In MCCRCC patients treated with sunitinib, VEGF SNP -634 is associated with hypertension and a combination of VEGF SNP 936 and VEGFR2 SNP 889 genotypes is associated with overall survival.
21867402 Plasma sVEGFR-2 concentrations in late onset preeclampsia are significantly lower than that of uncomplicated pregnant women only in patients without evidence of an underperfused placenta.
21864059 arachidonic acid significantly decreased methylation of the promoters of both KDR and Notch4 genes in Human umbilical vein endothelial cells.
21858086 Data suggest that GEP100-Arf6-AMAP1-cortactin pathway, activated by VEGFR2, appears to be common in angiogenesis and cancer invasion and metastasis, and provides their new therapeutic targets.
21849059 Data confirm the selectivity of VEGF(121)/rGel for VEGFR-2-overexpressing endothelial cells and represent the first analysis of genes governing intoxication of mammalian endothelial cells by a gelonin-based targeted therapeutic agent.
21827221 plasma concentration significantly lower in patients with mild preeclampsia who subsequently developed severe preeclampsia than in those who remained stable until term
21826315 VEGF covalently bound through a modified heparin molecule elicits an extended response of phosphorylated VEGFR-2 in HUVEC cells, and the covalent linkage reduces internalization of the growth factor during receptor endocytosis
21808992 Data suggest that arterial dysfunction found in patients with beta-thalassaemia major before and after HSCT may be related to impaired proliferation of CD133(+)VEGFR2(+) and CD34(+)VEGFR2(+) cells.
21751212 Data show that normal thyroid follicular cells express VEGFRs 1, 2, and 3.
21724587 majority of the thermodynamically destabilizing missense mutations were located in exon 1 in the core of pVHL, whereas protein surface mutations in exon 3 affected the interaction domains of elongin B and C
21715322 galectin-3 contributes to the plasma membrane retention and proangiogenic function of VEGF-R2.
21712447 Findings may have important implications for understanding the molecular basis of genetic associations between KDR variation and clinical phenotypes related to VEGFR-2 function.
21705026 Single nucleotide polymorphisms and haplotype of kinase insert domain-containing receptor KDR play crucial roles in the increased risk of ischemic stroke in the Korean population.
21694464 Studies indicate that 48 biomarkers have been identified for ccRCC patients, only CD44, CA9, p53, Ki67 and PCNA have shown prognostic value, and IMP-3 and VEGF-R2 are predictors of survival of pRCC patients.
21692879 These data indicate that angiogenesis induced by Flk-1+ hBMSCs promotes endogenous neurogenesis, which may cause functional recovery after cerebral ischemia.
21683519 autocrine and/or paracrine VEGF/VEGFR signaling plays a functional role in some VEGF-sensitive cancers, including malignant astrocytoma and fi brosarcoma
21680174 RNAi-mediated silencing of VEGF-C inhibits non-small cell lung cancer progression by simultaneously down-regulating the CXCR4, CCR7, VEGFR-2 and VEGFR-3-dependent axes-induced ERK, p38 and AKT signalling pathways.
21671140 Immunohistochemical analysis of early-stage breast cancer: eNOS was found in 159 cases, VEGF in 131 cases, HIF-1alpha in 139 cases, VEGFR2 in 185 cases and inducible NOS in 22 cases.
21667138 A cell penetrating peptide derived from azurin inhibits angiogenesis and tumor growth by inhibiting phosphorylation of VEGFR-2, FAK and Akt.
21659473 These findings reveal a novel role of DCN as an antagonistic ligand for VEGFR-2.
21658307 Anti-TNF-alpha antibody (infliximab) therapy for Crohn's disease supports the recovery of eNOS and VEGFR2 protein expression in endothelial cells.
21653826 VEGF binding to NRP1 is essential for VEGF stimulation of endothelial cell migration, complex formation between NRP1 and VEGFR2, and signaling via FAK Tyr407 phosphorylation.
21636804 Thioredoxin-interacting protein mediates TRX1 translocation to the plasma membrane in response to tumor necrosis factor-alpha: a key mechanism for vascular endothelial growth factor receptor-2 transactivation by reactive oxygen species.
21635552 findings show VEGFR-2 and VEGFR-3 expression are markers of a poor prognosis in patients with surgically resected colorectal adenocarcinoma, whereas EGFR has a minor influence
21612582 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
21605611 Concomitant vascular GRP-receptor and VEGF-receptor expression in human tumors provides molecular basis for dual targeting of tumoral vasculature.
21599511 Report Flk-1 production in mouse quadriceps muscle using adeno-associated virus vectors.
21596751 endorepellin requires both the alpha2beta1 integrin and VEGFR2 for its angiostatic activity
21590454 High VEGFR2 is associated with recurrence in hepatocellular carcinoma.
21586748 Our data establish a distinct role of NRP-1 in VEGFR-2 signaling and reveal a general mechanism for the function of coreceptors in modulating receptor tyrosinase kinase signal output
21544626 Micro RNA 200b (miR-200b) negatively regulates VEGF signaling by targeting VEGF and its receptors, Flt-1 and KDR, acting as an angiogenesis inhibitor.
21539813 VEGFR2 receptor tyrosine kinase undertakes a constitutive recycling pathway between the peripheral endosomes and cell surface and this exists in both vascular and non-vascular cells.
21524919 DC electric stimulation selectively regulates production of some growth factors and cytokines important for angiogenesis through a feed-back loop mediated by VEGF receptors.
21498704 Medium and high expression of both F1+2 and VEGF:VEGF2 in association with colon cancer cells and endothelial cells was demonstrated.
21481963 can be used as an independent prognostic biomarker in combination with VEGF-A in advanced non-small-cell lung cancer
21478036 Low VEGFR-2 expression is associated with response to therapy in metastatic renal cell carcinoma.
21445972 VEGF directly suppresses T cell activation via VEGF receptor type 2.
21424032 The density of microvascularization was assessed using CD34 monoclonal antibody (hot spot technique), the expression of angiogenic factors VEGFR, EGFR and COX-2 were determined in tumor biopsies by specific immunohistochemistry techniques
21412269 Serum VEGFR-2 levels were significantly decreased from gestational hypertension to eclampsia groups as compared with the control level.
21409488 Decreased expression of VEGFR-2 is associated with angiosarcoma.
21402774 VEGFR-2 contains a unique PEST domain-like sequence that regulates the degradation of VEGFR-2 and the ubiquitination of VEGFR-2, which promotes VEGFR-2 degradation by serving as a recruitment site for the F-box-containing ubiquitin E3 ligase beta-Trcp1.
21396771 bronchial washing VEGFR2 levels are correlated to overall survival in non-small cell lung cancer patients
21389833 Inhibition of VEGFR2 kinase with a specific Inhibitor, protein tyrosine kinase inhibitor II (PTKi-II), does not affect capillary-like structure formation.
21388971 These data show targeting VEGFR-2 outside of the ligand binding domain results in potent inhibition of VEGFR-2 signaling and inhibition of angiogenesis in vitro and in vivo.
21382277 High articular levels of the angiogenetic factors VEGF and VEGF-receptor 2 as tissue healing biomarkers after single bundle anterior cruciate ligament reconstruction.
21382095 amplification of PDGFRA, KIT and KDR may be implicated in the pathogenesis of a small fraction of both subtypes of glioblastoma
21343372 Data suggest that targeting VEGFR-1 or VEGFR-2 expressing cells is effective in controlling the osteoblastic progression of PCa in bone.
21303671 During development of undamaged human forebrain, VEGF is always expressed in neurons, astrocytes and neovessel walls, contrary to VEGFR-2, which is only expressed in dispersed astrocytes.
21257617 the VEGF/KDR system jointly contributes to recurrent miscarriage in Taiwanese Han women
21220477 Data sugggest that The inhibition of EGFR and VEGFR2 by vandetanib and its tremendous in vivo antitumor activity against ATC make it an attractive candidate for further preclinical and clinical development for the treatment of this cancer.
21219538 Reduced serum VEGFR-2 is associated with gastric cancer.
21208810 Data show that high serum VEGF levels are closely related to the activation status of the VEGFR2/KDR receptor in cancer cells, indicating a stimulatory effect of serum VEGF on the VEGF pathway contributing to tumor progression.
21208252 Phosphorylated VEGFR-2 is detected on endothelial cells in paediatric pilocytic astrocytoma
21191630 this study provides little evidence that VEGF and VEGFR2 polymorphisms are important for glioblastoma survival.
21190990 after VE-cadherin induction by DMP1, DMP1 inhibited VEGFR-2 phosphorylation and Src-mediated signaling; DMP1 is identified as a new specific inhibitor of VEGF-induced angiogenesis
21177802 Inhibition of VEGFR2 and Src kinases blocks ANDV-induced endothelial cell permeability.
21173732 Report age-related differences in the expression of VEGFR-2 in the wall of varicose veins of women.
21168388 VEGFR1:VEGFR2 ratio is substantially increased during hypoxia to block VEGF-A-stimulated and VEGFR2-regulated endothelial responses to maximize cell viability and recovery.
21165437 Histological analysis demonstrated an increase in the number of blood vessels and expression of CD34 and vascular endothelial growth factor in hepatocellular carcinoma tissue compared to adjacent liver tissue
21163065 VEGFR-2 expression was significantly correlated with tumor size, histological grade and distant metastasis of papillary renal cell carcinoma.
21159176 Suggest that while heterogeneous expression of VEGFR2 is a feature of human tumors, it may not affect response to low dose metronomic cyclophosphamide treatment and possibly other anti-angiogenic approaches.
21131553 BIBF 1120, a triple angiokinase inhibitor, has an effect on VEGFR2+pTyr+ peripheral blood leukocytes
21129272 The proliferation of A549 cells is inhibited significantly and the apoptosis of cells is induced by inhibiting VEGFR2 expression with RNAi.
21098094 Data show that VEGFR2 is up-regulated on vascular endothelial cells and epithelial cells in mouse and human CAC.
21084743 The immediate micromechanical stiffening is dependent on activation of the vascular endothelial growth factor receptor (VEGFR)-2, because inhibition of the receptor abrogates the micromechanical response.
21063020 Importance of syntaxin 6 in the maintenance of cellular VEGFR2 levels.
21062896 MT1-MMP regulates VEGF-A expression through a complex with VEGFR-2 and Src.
21048041 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21047416 the ability of soluble forms of perlecan domain i to modulate vascular endothelial growth factor-165 (VEGF165) enhanced capillary tube-like formation, and VEGF receptor-2 phosphorylation
21041381 Results suggest an important role of VEGFR-2 in Granulos Cell Tumor (GCT) pathology & support the possibility of applying novel VEGFR-2-targeted treatments to patients with GCT.
20963665 The level of VEGFR2 expression in patients with a background of breast cancer in pregnancy or lactation was significantly higher than in age-matched patients with sporadic breast cancer at the same stages of the disease.
20959405 Observational study of gene-disease association. (HuGE Navigator)
20923780 Thrombospondin-1 inhibits VEGF receptor-2 signaling by disrupting its association with CD47
20854187 results suggest that VEGF is involved in hemangioma angiogenesis but that soluble VEGFRs marginally influence this process; lower serum levels of sVEGFR1 in hemangioma patients indicate the possible dysregulation between VEGFR1 and VEGFR2 receptors
20851763 Vascular Endothelial Growth Factor Receptor-2 crosstalk with Muscarinic acetylcholine receptors to enhance mTOR activity but signal divergent effects on survival through alternate mechanisms.
20842453 Vascular endothelial growth factor stimulates osteoblastic differentiation of cultured human periosteal-derived cells expressing vascular endothelial growth factor receptors
20824203 a novel mechanism by which EMMPRIN promotes tumor progression through HIF-2alpha/VEGFR-2 mediated mechanism
20800603 Observational study of gene-disease association. (HuGE Navigator)
20716285 Inhibition of VEGFR2 augments cigarette smoke-induced oxidative stress and inflammatory responses leading to endothelial dysfunction.
20706192 Observational study of gene-disease association. (HuGE Navigator)
20695190 Immunohistochemical evaluation of VEGF and VEGFR-1 overexpression may be a useful marker for predicting 5-year disease free survival in endometrioid endometrial cancer.
20686603 Co-expression of VEGF and its receptor VEGFR-2 (KDR) was present in MPNST cell lines suggesting an autocrine loop.
20674013 hypercapillarization previously described in the placenta of women with mild hyperglycemia may result from the downregulation of VEGFR- 1, thereby enhancing VEGF/VEGFR-2 interaction and the activation of angiogenesis.
20635108 aneurysm formation associated with a loss of expression of VEGFR1, moderate expression of VEGFR2 and high concentration of nitrate.
20630084 Single Nucleotide Polymorphisms in VEGFR2 gene is associated with hypertension and hand-foot skin reactions in therapy related cancer.
20630084 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20615131 VEGF-A, VEGFR-1, and VEGFR-2 immunoreactive proteins are overexpressed in medullary thyroid carcinoma lesions and might be implicated in tumor progression
20606037 The VEGFR-2 is primarily localized to, and significantly upregulated on, tumor vasculature (blood and/or lymphatic) supporting the majority of solid cancers.
20602615 Observational study of gene-disease association. (HuGE Navigator)
20548028 Data demonstrate that the mechanosignaling cascade is initiated by vascular endothelial growth receptor-2 (VEGFR2) activation.
20538805 Findings demonstrate that induced expression of KDR on subsets of T cells, and locally expressed VEGF, facilitate EC-dependent lymphocyte chemotaxis.
20529868 Vascular endothelial growth factor receptor-2 activates ADP-ribosylation factor 1 to promote endothelial nitric-oxide synthase activation and nitric oxide release from endothelial cells
20510958 A lower maternal plasma sVEGFR-2 concentration precedes the development of preeclampsia, both term and preterm.
20501673 Data hypothesize that VEGFR-2 forms a signaling complex with S1P(1) and and protein kinase C-alpha , evoking bidirectional signaling regulating both ERK1/2 phosphorylation and haptotaxis of ML-1 cells.
20485168 Studies indicate that inhibition of the VEGF/VEGFR pathway may be a rational and effective therapy for certain patients with angiosarcoma, EHE, and HPC/SFT.
20484670 provide evidence that soluble VEGF receptors promote mural cell migration through a paracrine mechanism involving interplay in ECs between VEGF/VEGFR-2 and S1P/S1P1 pathways that leads to endothelial nitric oxide synthase activation
20473929 expression of sVEGFR-2 may explain the inverse relationship between VEGFR-2 expression and PI3K/Akt signaling
20471686 We expand previous data on the association of AMD with VEGF-A gene variations and identify for the first time an association with variations in the KDR gene.
20471686 Observational study of gene-disease association. (HuGE Navigator)
20463083 Results suggest that pathogenic hantaviruses disrupt fluid barrier properties of endothelial cell adherens junctions by enhancing VEGFR2-VE-cadherin pathway responses which increase paracellular permeability.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20446891 Observational study of gene-disease association. (HuGE Navigator)
20395257 not only the existence of a glomerular paracrine proangiogenic, but also an autocrine role of the VEGF-VEGF-R system in diseased podocytes.
20389299 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20388479 Radix Ginseng and Radix Notoginseng formula can promote HUVEC proliferation and secretion of VEGF and VEGFR2.
20367641 The expression of pVEGFR-2 might be a novel predictive prognostic marker for patients with pancreatic cancers, especially at clinical stage IIA.
20360595 Cells expressing VEGFR2 (in combination with CD34 or CD133) are significantly increased during second and third trimesters of uncomplicated pregnancy compared to the first trimester but are reduced in women with preeclampsia.
20236940 VEGF release and the subsequent activation of VEGF receptor 2 link loricrin gene mutations to rapid cell proliferation in a cellular model of loricrin keratoderma.
20224550 Both VEGFA and VEGFC potently induce formation of VEGFR2/-3 heterodimers.
20222950 VEGF-A, VEGFR1 and VEGFR2 have roles in events occurring at the invasive tumour front
20218294 Ginsenosides Rg3 can down-regulate the expressions of KDR and VEGF in human lung squamous cancer SK-MES-1 cells.
20215856 Observational study of gene-disease association. (HuGE Navigator)
20195243 Data show that VEGFR2 RNA interference induced an induction of more aggressive cellular behavior in transfected EOC cells.
20182906 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20179233 We provide evidence for the downregulation of the lymphangiogenesis inhibitor sVEGFR-2 in metastatic neuroblastoma stages
20170163 Studies show the design and development of dual VEGF-R2/PLK1 inhibitors.
20167365 VEGFR2 expression was significantly reduced in all cases of preeclampsia compared to control placentas.
20164029 A dysregulation of the placental expression of the VEGFR-2 related to the different degrees of the gestational periods.
20158395 Pregnancies with a fetal death, at the time of diagnosis, are characterized by a decrease in the maternal plasma concentration of sVEGFR-2, but an increase in the amniotic fluid concentration of this protein.
20158393 amniotic fluid concentration not lower in preterm premature rupture of membranes
20145116 Results provide significant insights into the structural features that determine the high affinity and specificity of VEGF/VEGFR interactions.
20143086 an impact of two SNPs in the VEGRF-2 gene on neoangiogenesis in patients with colorectal cancer
20135347 High VEGFR2 expression, EGFR expression, and EGFR gene copy number were significantly correlated to triple-negative breast cancer
20135347 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20124452 phosphoinositide 3-kinase and RAS-RAF pathways drive the activity of RAF265, a novel RAF/VEGFR2 inhibitor, and RAD001 (Everolimus) in combination
20103629 Data show that that among known sunitinib targets, only platelet-derived growth factor receptor-beta and vascular endothelial
20103598 farnesiferol C exerts antiangiogenic and antitumor activity and targets multiple aspects of VEGFR1 (Flt1) or VEGFR2 (Flk1) signaling cascades
20084057 Ala+TIMP-2 selectively alters the phosphorylation pattern of VEGFR-2 after VEGF-A stimulation and disrupts the downstream activation of PLC-gamma, Ca(+2) flux, Akt, and eNOS, as well as decreasing cGMP levels.
20084021 VEGF might be involved in several aspects of neural cell development, including migration, differentiation, synaptogenesis, and myelination, and VEGFR-2 might be one of the main receptors that mediate these processes.
20048182 Objective antitumor activity and antiangiogenic effects were observed over a wide range of dose levels, suggesting that ramucirumab may have a favorable therapeutic index in treating malignancies amenable to VEGFR-2 inhibition.
20032607 VEGFR2+ cell count around poorly differentiated tumors was significantly higher than that around well differentiated tumors
20026801 Metronomic dalCMP is safe, well tolerated, and clinically active in metastatic breast cancer, but there was no correlation between response and VEGF, sVEGFR-1, or sVEGFR-2 levels.
20019880 This study is the first to investigate the association of VEGFR-2 polymorphisms with age-related macular degeneration (AMD) and evaluates VEGFA genetic variants in the largest neovascular AMD cohort to date.
20019880 Observational study of gene-disease association. (HuGE Navigator)
20008289 a novel function for VEGF and KDR in CD45RO+ memory T cell responses
19965681 EPO induction of NO is dependent on the betaC-R and VEGF-R2; VEGF induction of NO is dependent on the expression of the betaC-R, and that the betaC-R and VEGF-R2 interact
19953880 The VEGFR-2 gene variants may serve as novel genetic markers for the risk of hemorrhagic stroke.
19953880 Observational study of gene-disease association. (HuGE Navigator)
19936766 VEGFR1, VEGFR2, and PDGFRalpha are over-expressed in K-ras mutated colorectal adenocarcinoma.
19924384 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19902430 showed that vascular endothelial growth factor receptor 2 (VEGFR2) is selectively expressed by FOXP3high but not FOXP3low Treg.
19888537 VEGFR-2 was significantly upregulated by alpha-v suppression in HUVEC & downregulated in HMVEC at mRNA & protein levels. Suppression of alpha-v can either augment or inhibit VEGFR-2 levels & VEGF-induced proliferation in EC from different vascular beds.
19884766 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
19881969 VEGFR-2 is significantly reduced in association with pre-eclampsia.
19875757 VEGFR2 gene polymorphism correlates with cytogenetic response, treatment failure following imatinib therapy for chronic myeloid leukemia.
19875757 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19862822 KDR may be amplified in fibrosarcoma of bone.
19860625 Data show that CLL cells express LPA receptors LPA(1-5) and VEGF receptors, and the plasma levels of VEGF are elevated in CLL patients.
19857463 These findings suggest that NRP-1-VEGFR-2-complex formation may contribute to effective cellular functions mediated by VEGF(165) in megakaryocytic cells.
19850021 Data show that patients and controls had similar sVEGFR-2 levels, but VEGF levels were lower and sVEGFR-1 higher in patients with autism.
19837976 Data show that EMMPRIN up-regulate hypoxia-inducible factor-2alpha, VEGFR-2, and the soluble forms of VEGF in endothelial cells, thus directly regulating the angiogenic process.
19837659 alphav beta3 integrin may, in part, negatively regulate VEGF signaling by sequestering NRP1 and preventing it from interacting with VEGFR2
19834490 Data demonstrate that VEGF-induced angiogenesis requires inverse regulation of VEGFR1 and VEGFR2 in tumor-associated endothelial cells.
19811263 A statistically significant increase of sVEGF-R2 and significant decrease of sVEGF-R1 were observed in the subgroup of newly diagnosed SLE patients as compared to the control subjects.
19782046 there is a novel relationship between glucose exposure and expression at the transcriptional and translational levels of VEGF, VEGFR2, and NRP-1 in epithelial ovarian carcinoma cells.
19779861 KIT, PDGFRA, and VEGFR2 amplifications were all present in 4% of Medulloblastomas and primitive neuroectodermal tumor and KIT amplification was associated with concurrent PDGFRA and VEGFR2 amplifications
19776290 Medullary thyroid carcinoma metastases showed a higher VEGFR2 expression than primary tumors.
19773544 Data suggest that the coreceptor function of CD44v6 for c-Met and VEGFR-2 is a promising target to block angiogenesis in pathologic conditions.
19741061 There is strong evidence that VEGF and its receptors are involved in the onset of sarcoidosis and influence its course.
19741061 Observational study of gene-disease association. (HuGE Navigator)
19726758 To study the role of dimerization in receptor activation we created a series of dimerization-promoting transmembrane domain (TMD) mutants lacking the extracellular domain. Dimerization is necessary, but not sufficient, for receptor activation.
19707156 VEGFR2 was expressed in the majority of pre-B-ALL bone marrow samples.
19706681 VEGFR2-PLCgamma1 signal relay gives rise to the unique function of VEGFR2, thus enabling endothelial differentiation from vascular progenitors.
19706677 These data establish a novel role for SHP-2 phosphatase in the dopamine-mediated regulation of VEGFR-2 phosphorylation.
19701853 High cytoplasmic KDR expression in diffuse large-cell lymphoma correltaed with poor survival.
19695569 VEGF receptor-2 is increased in sera of subjects with metabolic syndrome in association with insulin resistance
19665480 Results manifested that VEGFR2-based DNA chimeric vaccine could be developed as a promising approach for tumor immunotherapy.
19636022 Phase I dose escalation study of telatinib, a tyrosine kinase inhibitor of vascular endothelial growth factor receptor 2 and 3, platelet-derived growth factor receptor beta, and c-Kit, in patients with advanced or metastatic solid tumors.
19633424 The present study evaluated the epigenetic gene silencing of VEGF and VEGFR genes in cancer tissues.
19605404 Study provides novel insights for angiogenesis mechanisms in pediatric solid malignancies for which antiangiogenic targeting of VEGFR2+-BMD progenitors could be of interest.
19595210 Abnormal expression of VEGF and Flk-1/KDR may be the initiating factor of angiogenesis in the process of breast hyperplasia-atypical hyperplasia-breast cancer.
19570985 VEGFR2, but not VEGFR1, is responsible for the release of von Willebrand factor.
19563658 analysis of the experssion of EGFR, PDGFRA and VEGFR2 in cervical adenosquamous carcinoma
19563658 Observational study of gene-disease association. (HuGE Navigator)
19558547 (-)-Epigallocatechin gallate can exert, at least in part, its growth-inhibitive effect on HCC cells by inhibiting the VEGF-VEGFR axis
19521715 In conclusion, we have shown for the first time that variation in the VEGFR2 gene is associated with elite athlete status, endurance performance of female rowers and muscle fibre type composition.
19521715 Observational study of gene-disease association. (HuGE Navigator)
19520980 VEGF-2 gene variants may serve as novel genetic markers for the risk of stroke and its recurrence.
19520980 Observational study of gene-disease association. (HuGE Navigator)
19469899 Repression of the small Rho GTPase Rac1 in human endothelial cellsseems to be an additional critical molecular mechanism in the regulation of VEGFR2 expression.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19435508 271 G>A polymorphism of the KDR gene is related to transcriptional regulation in patients with non-small cell lung cancer.
19419943 The aim of the study was to assess the usefulness of soluble angiogenesis markers such as endoglin and VEGFR2 in gastric cancer patients and to compare these results with those of VEGF levels.
19409555 The presence of the VEGF-A receptors, particularly in the granulosa cells, suggests that VEGF-A might be involved in proliferation initiation of primordial follicles or play an as yet unknown role in human preantral follicles.
19375500 We have identified a VEGFR2/NOX4 regulatory pathway by which Ox-PAPC controls important endothelial functions.
19372622 KDR/CD34 and IL-10 are major independent predictors of 30-day major adverse clinical outcome in ST-segment elevation acute myocardial infarction patients undergoing primary coronary angioplasty.
19372461 Rab GTPase regulation of VEGFR2 trafficking and signaling in endothelial cells; Endothelial cell migration was increased by Rab5a depletion but decreased by Rab7a depletion
19372376 Includes the study of a polymorphic upstream ORF in this gene, and shows that it functions to reduce protein levels by ~50%.
19324448 expressionin cancer tissue has no prognostic impact in non-small cell lung cancer patients
19287991 In contrast to sVEGFR-1, sVEGFR-2 was significantly decreased in both normal colonic tissue and human colon cancer tissue under hypoxic conditions.
19267251 REVIEW: possible mechanisms which mediate formation of the complex between VEGFR-2 and alphavbeta3 on endothelial cells
19265684 these findings suggest that CCL23 results in up-regulation of KDR/flk-1 receptor gene transcription and protein expression and that KDR/Flk-1 up-regulation induced by CCL23 may contribute to potentiation of VEGF action in angiogenesis.
19261502 Soluble VEGFR-2 was lower in Dengue Fever and Dengue Hemorrhagic Fever patients compared to study controls.
19246491 extracellular RNA serves an important cofactor function to engage VEGF for VEGF-R2-dependent signal transduction
19244479 chronic hypoxia attenuates VEGF-stimulated signaling in coronary artery endothelial cells by specific downregulation of KDR expression
19218116 In breast cancer patients, Flk-1/KDR was strongly expressed in vascular endothelial cells.
19200976 A local defect of both VEGF transmembranous receptors (KDR and Flt-1) in the endometrium covering the septal area may be responsible for the clinical comportment of this mullerian anomaly.
19199116 secretion and the regulation of the secretion of sVEGFR-2 by microvascular endothelial cells derived from the tissue of benign prostatic hyperplasia
19179362 Vascular endothelial growth factor receptor-2 (VEGFR-2) expression was significantly suppressed in Fut8(-/-) mice, suggesting that Fut8 was required for VEGFR-2 expression.
19177438 VEGFr2 up-regulation is a feature of poor differentiation and tumor progression.
19176370 In malignant pleural mesothelioma cells, plexin-A1 and VEGF-receptor 2 (VEGF-R2) are associated in a complex which are involved in survival pathways.
19160077 no activating mutations in the tyrosine kinase domain of the VEGFR-2 were identified in 66 hepatocellular carcinoma samples
19160077 Observational study of gene-disease association. (HuGE Navigator)
19141860 Observational study of gene-disease association. (HuGE Navigator)
19136612 VE-PTP, regulates VEGFR2 activity thereby modulating the VEGF-response during angiogenesis.
19110567 No significant correlations between the levels of VEGFR2 in the blood and renal cancer tissue were found.
19082506 VEGFR2 was significantly decreased in human colonic microvascular endothelial cells under hypoxia. In contrast, the responses of VEGFR2 levels to hypoxia in human umbilical vein endothelial cells were variable, that is, either unchanged or up-regulated.
19068081 High VEGFR-2 in stromal vessels is associated with gastric cancer.
19066962 The expression of VEGF-A, VEGFR-1, VEGFR-2, and VEGFR-3 in was higher in peritumoral liver tissue, while VEGF-C expression was higher in tumor.
19058181 a distinct VEGFR-2-mediated pathway promoting tumor growth through autocrine mechanisms.
19023980 Results show a significant positive correlation between the concentrations of tissue VEGF and its receptor VEGFR2 in primary breast neoplasms during neoadjuvant therapy, and suggest that VEGFR2 levels may indicate the level of lymphatic metastasis.
19021062 LDH5 is highly upregulated in B-cell non-Hodgkin lymphomas and is in direct relation to factor HIF1alpha and HIF2alpha expression. LDH5 expression is linked with activated VEGFR2/KDR expression
19020728 glioma cells enhance EPC angiogenesis via VEGFR-2, not VEGFR-1, mediated by the MMP-9, Akt and ERK signal pathways
19014781 Achieving optimal therapeutic outcomes, the scheduling of radiotherapy and antiangiogenic therapy requires patient-specific post-treatment monitoring of the VEGFR2 pathway.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18987662 correlation between expression of VEGF and p27(Kip1) was observed in bone marrows from patients with acute myeloid leukemia
18975312 Observational study of gene-disease association. (HuGE Navigator)
18931684 Normalization of the constitutive VEGFR2 signaling in hemangioma endothelial cells with soluble VEGFR1 or antibodies that neutralize VEGF or stimulate beta1 integrin
18922344 VEGF-R2 expression is significantly increased in port-wine stains, suggesting that VEGF-R2 could contribute to the pathogenesis of PWS by inducing vessel proliferation, vasodilation, or both.
18840653 matrix-controlled TCPTP phosphatase activity can inhibit VEGFR2 signalling, and the growth, migration and differentiation of human endothelial cells
18824714 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18818406 VEGF-A stimulates ADAM17-dependent shedding of VEGFR2 and crosstalk between VEGFR2 and ERK signaling.
18785001 Observational study of gene-disease association. (HuGE Navigator)
18784964 The tumor uptake of 64Cu-DOTA-VEGF measured by small-animal PET imaging reflects tumor VEGFR-2 expression level in vivo.
18719373 These results are consistent with a potential autocrine role of the VEGF-VEGFR2 (KDR) interplay as a factor contributing to malignant astrocytoma growth and radioresistance.
18692535 in vascular endothelial cells the binding of adrenomedullin to its AM1 receptor could trigger a transactivation of the VEGFR-2 receptor, leading to a signaling cascade inducing proangiogenic events in the cells.
18656381 sVEGFR-2 levels were not significantly increased in patients with liver cirrhosis.
18651620 PTHrP (107-139) interacts with VEGFR-2 to promote human osteoblastic cell survival by a mechanism involving Runx2 activation.
18645275 vascular endothelial growth factor, receptor KDR and p53 protein are expressed in transitional cell carcinoma of the bladder
18628209 binding of Neuropilin-1 to VEGFR-2 requires the PDZ-binding domain of neuropilin-1
18609713 VEGFR-2 levels were associated with poor tumor differentiation in patients with gastric adenocarcinoma
18594014 the 167-181 region of VEGFR-2 has an important role in the stimulation of CD4(+) T cell responses to VEGFR-2 protein
18564921 Observational study of gene-disease association. (HuGE Navigator)
18509004 complex interaction between sphingosine-1-phosphate and VEGFR-2 in ML-1 thyroid follicular cancer cells, particularly in regulating migratory responses
18443354 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
18421240 VEGF is considered as an important factor in the pathogenesis of macular edema. VEGF induces the rupture of the blood retinal barrier and may also influence the retinal pigment epithelial (RPE) outer retinal barrier.
18396391 Intensity of VEGFR-2 in odontoblasts increases from cap stage to late bell stage.
18379357 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18356031 Found in normal and neoplastic thymus tissue.
18337563 the temporal expression of TNF is critical: it delays angiogenesis initially by blocking signaling through VEGFR2, and by inducing a tip cell phenotype through an NFkappaB-dependent pathway, it concomitantly primes ECs for sprouting
18317954 Surveillance of VEGFR-2 levels to predict chemotherapy response is not useful.
18261985 The expression of VEGF-C and VEGF receptors is regulated specifically in HL-60 cells during macrophage differentiation.
18223683 Gal-1 can directly bind to NRP1 on endothelial cells, and can promote the NRP1/VEGFR-2-mediated signaling pathway as well as NRP1-mediated biological activities.
18218912 a maximal bout of exercise induces a significant shift in CD34+ cells toward CD34+/KDR+ cells
18211808 Overall, these results indicate that HDAC6 and HDAC10 play important roles in Hsp-mediated VEGFR regulation.
18194650 These proteins have an essential molecule required for promoting the disruption of endothelial cell-cell contacts and paracellular permeability.
18175243 Preeclampsia and SGA are associated with low maternal plasma concentrations of soluble vascular endothelial growth factor receptor-2 (sVEGFR-2)
18164591 Support a role for NP-1 in mediating synergistic effects between VEGF-A(165) and FGF-2, which may occur in part through a contribution of NP-1 to KDR stability.
18162457 Increased levels of Factor VIII occurred in the precursors of cardiac myocytes, smooth muscle and endothelial cells in normal and post-ischemic hearts.
18037047 expressed in the microvascular endothelial cells of both primary and young permanent teeth
18035072 Observational study of gene-disease association. (HuGE Navigator)
18006432 Activation of fractalkine/CX3CR1 by vascular endothelial cells induces angiogenesis through VEGF-A/KDR.
17999592 Within mdx mice, an animal model of DMD, adipose tissue-derived Flk-1(+) MSCs (AD-MSCs) homed to and differentiated into cells that repaired injured muscle tissue.
17979890 VEGFR2 up-regulation had no effect on VEGF-induced cell proliferation, but significantly enhanced endothelial progenitor cells migration and pseudotubes formation dependent on integrin alpha(6) subunit overexpression.
17961532 Expression profile of total VEGF, VEGF splice variants and VEGF receptors in the myocardium and arterial vasculature of diabetic patients.
17928406 points to VEGFR2 transactivation as an important signaling pathway used by chemokines such as IL-8/CXCL8
17927494 isolation and purification of Flk-1cells with mesenchymal stem cell characteristics from bone marrow of myeloma patients.
17891484 Observational study of gene-disease association. (HuGE Navigator)
17881084 HARP negatively affects diverse biological activities in C6 glioma cells, mainly due to binding of HARP to VEGF, which may sequester secreted VEGF from signalling through VEGFR2.
17868650 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
17850794 VEGF receptor Flk-1 is involved in c-kit up regulation via ERK-mediated pathway
17765237 Vascularization and VEGF and Flk-1 expression are significantly higher in deeply infiltrating endometriosis affecting the rectum.
17721629 studied circulating CD31- and/or CD34-positive cell populations with a low to moderate VEGFR2 expression in human volunteers and cancer patients.
17707181 Observational study of gene-disease association. (HuGE Navigator)
17707181 KDR polymorphisms may serve as novel genetic markers for the risk of coronary heart disease.
17702744 myoferlin forms a complex with dynamin-2 and VEGFR-2, which prevents CBL-dependent VEGFR-2 polyubiquitination and proteasomal degradation.
17651148 increase in VEGF in AR with and without asthma despite a higher Flk-1 in AR patients with asthma may be a possible explanation for the presence of angiogenesis in the airway wall in patients with asthma but not in those with pure AR.
17646929 PKA and VEGFR2 converge at the MEK/ERK1/2 pathway to protect serum starved neuronal cells from a caspase-dependent cell death.
17641225 c-Src controls functional association between integrin alphav-beta3 and VEGFR-2 via integrin beta3 phosphorylation.
17640715 Increased expression of Flk-1 may be involved in sinusoidal capillarization and the increased numbers of unpaired arteries in capillarized areas with increased numbers of unpaired arteries in dysplastic liver nodules.
17631646 ZD6474 treatment inhibited EGFR phosphorylation and led to a dose- and time-dependent decrease in nasopharyngeal carcinoma cell
17599955 determined the expression pattern of VEGF splice variants in NSCLC and its correlation with the clinicopathological characteristics of tumors
17584927 High levels of VEGFR-3 and -2 seem to contribute to the etiology of lymphangiomas.
17577783 Leukemia patients showing parallel activation of the studied proteins trended to exhibit higher incidence of fatal outcome.
17575273 VEGFR2 enhances VEGF(165), but not VEGF(121) binding to NRP1.
17490619 These findings provide evidence for a novel cooperative interaction between VEGFR2 and RET that mediates VEGF-A functions in ureteric bud cells.
17470361 VEGF receptor KDR was expressed in ovarian cancer cells, and CDDP-inhibited VEGF expression was linked with cellular apoptosis, which was rescued by VEGF treatment.
17462601 Taken together, these results lend great support to use PDGFRbeta antagonists in combinations with other antitumor and/or anti-angiogenic agents in the treatment of a variety of cancers.
17456229 Mechanisms other than genetic variation may downregulate expression or function of the VEGFR2 receptor in patients with ALS.
17372230 corecruitment of c-Cbl and PLCgamma1 to VEGFR-2 serves as a mechanism to fine-tune the angiogenic signal relay of VEGFR-2
17336974 Endometrial blood vessels possess a discrete morphology that is characterized by endothelial gaps, and these gaps are more pronounced in women with menorrhagia and overexpression of VEGFR2.
17293873 Binding of VEGF to membrane-distal immunoglobulin-like domains causes receptor dimerization and promotes further interaction between receptor monomers through the membrane-proximal immunoglobulin-like domain 7.
17242158 in binding VEGFR-2, furin and PC5 promote cleavage of N-and C-terminal VEGF-D propeptides, whereas PC7 promotes cleavage of the C-terminal propeptide only
17088944 These results suggest that the expression of VEGFRs and NRPs on keratinocytes may constitute important regulators for its activity and may possibly be responsible for the autocrine signaling in the epidermis.
17018613 Signaling via VEGFR-2 is involved in prostate lymphatic endothelial cell tube formation, migration, & proliferation in vitro. Blockade of VEGFR-2 significantly reduced tumor-induced activation of LECs.
17013089 VEGF regulation of angiogenesis may in part be due to enhanced proliferation of VEGFR-1 and VEGFR-2
16951193 SCID mice bearing xenografts of transfected cell lines were used to assess the effect of VEGF overexpression and the effect of VEGF receptor (VEGFR) 2 inhibition on soft tissue sarcoma growth.
16930552 VEGFR-2 expressed on HaCaT cells plays a crucial role in VEGF-mediated regulation of cell activity
16914267 perlecan secreted by VEGF165-stimulated endothelial cells may be involved in the regulation of cellular behavior during angiogenesis
16914140 Endothelial cell tissue transglutaminase (tTG) might be involved in modulation of the cellular response to VEGF by forming an intracellular complex with VEGFR-2, and mediating its translocation into the nucleus upon VEGF stimulation.
16909199 Taken together these data show that VEGF-A(165)b has attenuated signaling potential through VEGF receptor 2 defining this new member of the VEGF family as a partial receptor agonist.
16893970 Thus, vascular endothelial cadherin limits cell proliferation by retaining VEGFR-2 at the membrane and preventing its internalization into signaling compartments.
16870555 VEGF receptors are found on plasma cells from all groups of patients with multiple myeloma with the lowest expression on plasma cells from normal individuals
16835828 overexpression of VEGF, its receptors flt-1, KDR/flk-1 and TGF-beta interaction may play an important role in the ovarian cancer biology, with potential effects on tumor growth and angiogenesis
16835467 REVIEW: The binding of VEGF-A to VEGFR-2 causes receptor dimerization, kinase activation and autophosphorylation of specific tyrosine residues within the dimeric complex.
16807673 Observational study of gene-disease association. (HuGE Navigator)
16787925 Gab1 thus appears as a primary actor in coupling VEGFR-2 to PI3K/Akt, recruited through an amplification loop involving PtdIns(3,4,5)P3 and its PH domain
16786116 VEGFR-1 and VEGFR-2 have roles in differentiation of hepatocellular carcinoma
16782059 illuminate an important mechanism for notch/HESR1 regulation of VEGF-induced angiogenesis
16763549 NRP1 expression and its GAG modification post-transcriptionally regulate VEGFR2 protein expression.
16761623 VEGF and VEGFR-2 may have a role in progression of gastric cancer
16697675 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
16684957 Vascular endothelial growth factor165 (VEGF165) and semaphorin3A (SEMA3A) elicit pro- and antiangiogenic signals respectively in endothelial cells (ECs) by binding to their receptors VEGFR-2, neuropilin-1 and plexin-a.
16682007 In this study, we demonstrate that 1121B Fab is able to strongly block KDR/VEGF interaction, resulting in potent inhibition of an array of biological activities of VEGF, including activation of the receptor and its signaling pathway.
16678129 These results suggest that VEGFR2 cannot only be targeted by receptor tyrosine kinase inhibitors but also by drugs that downregulate Sp proteins or block Sp-dependent transactivation.
16648151 Immunohistochemical staining showed that VEGF-R2 were expressed in epithelial, stromal and endothelial cells.
16630933 Observational study of gene-disease association. (HuGE Navigator)
16630933 haplotype analysis showed that atopy prevalence was strongly associated with a haplotype (AGAG) of VEGFR2
16617095 In conclusion, EC death induced by high shear stress and VEGFR blockade leads to the production of factors, in particular TGF-beta1, that activate VSMC proliferation.
16574784 Sp3 and Sp4 cooperatively interact with ERalpha to activate VEGFR2
16557278 Phosphorylated KDR expression was significantly associated with poor prognosis.
16516857 We conclude that IL-6 triggers VEGF-induced angiogenic activity through increasing VEGF release, up-regulates KDR expression and phosphorylation through activating ERK1/2 signaling, and stimulates MMP-9 overexpression.
16513643 This study describes the first specific antagonist of VEGF-A165 binding to NP-1 and demonstrate that NP-1 is essential for optimum KDR activation and intracellular signaling.
16467880 We conclude that neoplastic cells show a variable expression of total and phosphorylated KDR in the nucleus.
16439688 New VEGFR2 containing cell subpopulation,which is apparently a precursor classical endothelial progenitor cells more potent with respect too homing and vasscular repair.
16375118 VEGF and its receptors many play key roles in the growth, invasion and metastasis of human laryngeal carcinoma cells.
16361360 Regulation of VEGF(165) signaling through the VEGFR-2 complex in response to cigarette smoke exposure in vivo, and in smokers with and without chronic obstructive pulmonary disease.
16339483 Type I collagen limits VEGFR-2 signaling by a SHP2 protein-tyrosine phosphatase-dependent mechanism 1.
16322069 LPC-induced Flk-1/KDR transactivation via c-Src may have important implications for the progression of atherosclerosis
16308314 vascular endothelial growth factor receptor-2 phosphorylation is inhibited by delphinidin
16260429 Blockade of either VEGF or its receptors with neutralizing antibodies significantly reduced cell viability and increased apoptosis levels of the VEGFR-positive thyroid tumour cell line.
16226108 An immunohistochemical analysis of VEGFR2 in pituitary adenomas was made.
16169405 Up-regulation of VEGF-A receptor VEGFR-2 in capillaries in menorrhagia could be involved in abnormal endometrial vascular structure and permeability.
16105658 assessed the role of VEGF and its receptors in osteoclastogenesis, in vitro, by culturing osteoclast precursors in the presence of VEGF, VEGF receptor-specific ligands, and blocking antibodies to VEGF receptors
16049137 dynamin-2 regulates KDR expression and function and hence plays an important role in VPF/VEGF mediated angiogenesis
16007196 role in modulating tumor neovascularization in conjunction with interleukin-3 receptor
15980434 KLF2 is a regulator of VEGFR2/KDR and has a role in regulating angiogenesis
15975559 decrease in expression is caused by C-reactive protein
15962006 key role of KDR in megakaryopoiesis
15941713 human VEGFR-2 promoter is functionally counter-regulated by TFII-I and TFII-IRD1.
15857508 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
15845615 Targeting the release of VEGF from tumor epithelial cells as well as blocking interactions between VEGF and VEGFR-2 on both endothelial and tumor epithelial cells may facilitate the development of antiangiogenic therapies for breast tumors.
15806151 Phosphorylated ERK1/2 was further associated with the presence of VEGFR2 (cohorts II and III) and the degree of phosphorylated Ets-2, indicating in vivo, a signalling cascade from VEGFR2 via ERK1/2 to Ets-2 phosphorylation
15714119 VEGFR-2 expression, co-localized in the cytoplasmic and nuclear membrane, is associated with progression towards invasive melanoma
15693894 VEGFR2 may be involved in the transcriptional regulation of T-cell lymphoma.
15673613 regulatory mechanisms involved in the attenuation of VEGFR-2 activation is mediated by nonclassical Protein Kinase C and the presence of serine sites in the carboxyl terminal of VEGFR-2
15638384 Blood levels correlate with lymph node involvement in colorectal cancer.
15637071 the activation of VEGFR-1 and VEGFR-2 heterodimer (VEGFR-1/R-2) is essential for PGI(2) synthesis mediated by VEGF-A(165) and VEGF-A(121), which cannot be reproduced by parallel activation of VEGFR-1 or -2 homodimers with corresponding agonists [VEGFR2]
15625130 The majority of embryonic stem cells with the potential to differentiate into osteoclasts expressed Flk-1.
15610528 These data support the involvement in melanoma growth and survival of a VEGF-dependent internal autocrine loop mechanism, at least in vitro.
15528360 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
15522955 NRP-1 modulates VEGFR-2 signaling-dependent mitogenic functions of VEGF and regulates endothelial cell adhesion to extracellular matrix proteins independently of VEGFR-2.
15507525 Axl stimulation by GAS6 results in inhibition of the ligand-dependent activation of vascular endothelial growth factor (VEGF) receptor 2 and the consequent activation of an angiogenic program in vascular endothelial cells
15500293 The VEGFR2, through interaction with VEGF, regulated adhesive and migratory properties of the cancer cells.
15492987 there was no significant correlation between VEGF and VEGF-R2 expression. VEGF-R2 expression was significantly increased on endothelial cell (
15474514 VEGFR-3 needs to be associated to VEGFR-2 to induce ligand-dependent cellular responses
15470196 Observational study of gene-disease association. (HuGE Navigator)
15470196 VEGF and its receptor, KDR, genes contributed to the development of coronary artery lesions in Kawasaki disease patients.
15291808 VEGF(165)-induced phosphorylation of KDR and PLCgamma was partially inhibited by PF-4
15284224 Inhibition by flk-1 kinase inhibitor SU1498 and failure of placental growth factor (PlGF) to up-regulate DAF confirmed the role of VEGF-R2 in VEGF-mediated DAF up-regulation.
15247219 VEGFR2 mediated phosphorylation of focal adhesion kinase is regulated by heat shock protein 90 and Src kinase activities
15183893 VEGFR2 initiates a clonogenic response in myeloid leukemia cells that is PI3-kinase dependent.
15175347 activation of the P2Y(2)R induced rapid tyrosine phosphorylation of vascular endothelial growth factor receptor (VEGFR)-2 in human coronary artery endothelial cells
15166498 Increased expression of KDR is associated with an aggressive angiogenic phenotype in melanoma.
15135259 In chronic lower limb ischemia, growth factor-1 (IGF-1) and IGF-2, were upregulated in atrophic and regenerating myocytes together with attenuated HIF, VEGF, and VEGFR-2 expression in the same cells.
15135240 vascular endothelial growth factor (VEGF) is strongly expressed in villous cytotrophoblast cells and subsequently in Hofbauer cells while its receptors Flt-1 and Flk-1 are found on vasculogenic and angiogenic precursor cells
15111490 PPARgamma1 has bifunctional properties in the regulation of KDR gene expression mediated via interaction with both Sp1 and Sp3
15082792 Data suggest that periostin-mediated angiogenesis derives in part from the up-regulation of the vascular endothelial growth factor receptor Flk-1/KDR by endothelial cells through an integrin alpha(v)beta(3)-focal adhesion kinase signaling pathway.
15060076 Nedd4-mediated vascular endothelial growth factor receptor-2 degradation is prevented by Grb10
15026417 Shb binds to tyrosine 1175 in the VEGFR-2, which regulates VEGF-induced formation of focal adhesions and cell migration, of which the latter occurs in a phosphatidylinositol 3-kinase-dependent manner
15016828 Tgf-beta mediated repression of flk-1/KDR and mediated repression of flk-1/KDR and VEGF signaling involves the inducible formation of inhibitory Hex-GATA signaling Hex-GATA involves the formation of Hex-GATA complexes.
14996703 VEGF receotor signaling regulates survival signals in CLL cells and that interruption of this autocrine pathway results in caspase activation and subsequent leukemic cell death.
14967383 Our data support a role for KDR in oviduct angiogenesis.
14764537 maximal P-selectin translocation and subsequent neutrophil adhesion was mediated by VEGF-A(165) on the activation of VEGFR-2/NRP-1 complex and required PAF synthesis.
14760936 the level of sVEGFR-2 is lower in active systemic lupus erythematosus than in inactive disease
14726393 KDR is constitutively phosphorylated and located at the nucleus of VEGF-producing leukemias; a KDR-specific intracellular inhibitor failed to block KDR nuclear IMPORT, but inhibited the constitutive activation of MAPK/Erk and PI3-kinase/AKT pathways
14724572 phosphorylation of Y1214 on VEGFR2 is required to trigger the sequential activation of Cdc42 and SAPK2/p38 and to drive the SAPK2/p38-mediated actin remodeling in stress fibers in endothelial cells exposed to VEGF
14704231 Intact caveolae are required for the VEGF/VEGFR-2-mediated MEK/ERK signaling cascade.
14691147 The expression of VEGF and KDR correlates highly with the normal ocular vascularization in humans
14687619 Specific VEGFR2 expression, examined in 27 B-CLL samples, was positive in 26 of them. The VEGF transduction pathway may be very active in CLL cells. Both its paracrine & autocrine pathways may contribute to their enhanced survival.
14674128 changing of transcriptional activity of VEGF gene and its receptor FLK-1 indicates an autocrine mechanism of regulation of angiogenic gene activity in the first step of carcinogenesis--low-grade intraepithelial lesions of the uterine cervix
14654077 VEGF, VEGFR-1 and VEGFR-2 are concomitantly expressed in pre-B ALL cells. Expression of the receptors is limited to the intra-cytoplasmic compartment and may suggest either internalization or a block in trafficking of the receptor to the surface.
14635716 Altered expression of vascular endothelial growth factor and FLK-1 receptor in chronically hypoxic carotid body.
14602571 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
14532277 TNF induces transactivation between Etk and VEGFR2, and Etk directly activates PI3K-Akt angiogenic signaling independent of VEGF-induced VEGFR2-PI3K-Akt signaling pathway.
12949011 in humans: 1) VEGF, KDR, and Flt-1 mRNA are increased by acute systemic exercise; 2) the time course of the VEGF, KDR, and Flt-1 mRNA responses are different from those previously reported in rats
12810080 These data indicate that activation of vascular endothelial growth factor receptor-2 prevents endothelial cell apoptosis by inhibiting p38 MAP kinase phosphorylation and reducing caspase-3 activity.
12670961 Gq/11 proteins mediate KDR tyrosine phosphorylation and KDR-mediated HUVEC proliferation through interaction with KDR.
12607599 Staining for the receptors VEGFR-1 and VEGFR-2 was positive in large lymphoid cells in stage IV non-Hodgkin lymphoma.
12560084 Fluid shear stress induced upregulation requires Sp1 transcription factor binding to specific response elements in the 5' regulatory region
12551914 A set of loop-1 and -3 structures in the novel vascular endothelial growth factor (VEGF) family member, VEGF-ENZ-7, is essential for the activation of this protein's signaling.
12464608 transcriptional activation of Flk-1 in endothelial cells requires the interaction between HIF-2alpha and Ets-1
12456025 VEGFR-2 has a role in regulating angiogenesis-related functions [review]
12439912 The expression of vascular endothelial growth factor and its receptors KDR and Flt-1 by gastric carcinoma tissues and cell lines was detected to elucidate the molecular mechanism of this growth factor in promoting tumor growth.
12426207 The binding of VEGF to its receptor, KDR, is necessary and sufficient to induce the gene expression profile induced by VEGF.
12213878 findings implicate altered VEGF and KDR signaling in pituitary tumorigenesis; PTTG stimulation of FGF-2 and VEGF expression in the presence of up-regulated growth factor receptors may account for angiogenic growth and progression of human pituitary tumors
12174363 KDR plays a key role in regulating the proliferation of HGCC and HVEC.
12067897 Expression of vascular endothelial growth factor receptor Flk1/KDR is induced by shear stress through the CT-rich Sp1 binding site.
11994280 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
11986954 CLL B cells consistently express VEGFR2 mRNA; co-expression of angiogenic molecules and receptors suggest autocrine pathways of stimulation.
11960378 Constitutive activation of Stat3alpha in brain tumors: localization to tumor endothelial cells and activation by the endothelial tyrosine kinase receptor (VEGFR-2)
11908876 VEGF, Flt1, and Flk1 can be considered as indicators of the malignancy potential of diffusely infiltrating astrocytomas. The expression of VEGF and the two receptors may be affected by the proliferative activity of tumor cells.
11852061 In this study we give evidence of Flt-1 and KDR receptors in platelets.
11824379 Involvement of VEGFR-2 (kdr/flk-1) but not VEGFR-1 (flt-1) in VEGF-A and VEGF-C-induced tube formation by human microvascular endothelial cells in fibrin matrices in vitro.
11809684 green tea catechins are novel inhibitors of VEGFR-2 activity.
11807987 A potential mechanism involved in hemangioma formation is the alteration of the FLK1 signaling pathway in endothelial and/or pericytic cells.
11693202 vitronectin increased the presence of all four growth factor receptors and most notably, VEGFR-1; in contrast, fibrin decreased all four receptors, especially FGFR-1 and FGFR-2
11688957 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
11409852 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
11145723 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
10873597 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
10590123 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
9621077 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells
8946838 Inhibition of sigma receptor or VEGFR causes a significant decrease in HIV-1 Tat- and cocaine-induced H2O2 generation in human pulmonary arterial smooth muscle cells

AA Sequence

MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGS      1 - 70
EQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITE     71 - 140
NKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQ    141 - 210
SIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQ    211 - 280
SGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRI    281 - 350
PAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP    351 - 420
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVED    421 - 490
FQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQ    491 - 560
PTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSNSTNDILIMELK    561 - 630
NASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMW    631 - 700
FKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVG    701 - 770
TAVIAMFFWLLLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL    771 - 840
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGG    841 - 910
PLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASSGFVEE    911 - 980
KSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLA    981 - 1050
RDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLK   1051 - 1120
EGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDS   1121 - 1190
GLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS   1191 - 1260
GMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLI   1261 - 1330
EIGVQTGSTAQILQPDSGTTLSSPPV                                               1331 - 1356
//

Text Mined References (761)

PMID Year Title
26981634 2016 The Association between VEGFR Gene Polymorphisms and Stroke: A Meta-Analysis.
26890264 2016 Evaluation of Vascular Endothelial Growth Factor and Its Receptors in Human Neointima.
26879375 2016 Hydrogen sulfide promotes angiogenesis by downregulating miR-640 via the VEGFR2/mTOR pathway.
26853422 Genomic profiling in a homogeneous molecular subtype of non-small cell lung cancer: An effort to explore new drug targets.
26735859 2016 Recurrent CIC Gene Abnormalities in Angiosarcomas: A Molecular Study of 120 Cases With Concurrent Investigation of PLCG1, KDR, MYC, and FLT4 Gene Alterations.
26709129 VEGF/VEGFR2 Axis in Periodontal Disease Progression and Angiogenesis: Basic Approach for a New Therapeutic Strategy.
26655705 2016 An endothelial TLR4-VEGFR2 pathway mediates lung protection against oxidant-induced injury.
26653034 2016 IL-8 and VEGFR-2 polymorphisms modulate long-term functional response to intravitreal ranibizumab in exudative age-related macular degeneration.
26627848 2016 Differential expression of vascular endothelial growth factor A, its receptors VEGFR-1, -2, and -3 and co-receptors neuropilin-1 and -2 does not predict bevacizumab response in human astrocytomas.
26600539 2015 KDR gene silencing inhibits proliferation of A549 cells and enhances their sensitivity to docetaxel.
26600200 2015 VEGFR2 Gene Polymorphism Correlates with Deep Venous Thrombosis Risk in Chinese Han Population.
26577922 2015 The interaction of uPAR with VEGFR2 promotes VEGF-induced angiogenesis.
26541778 2016 PET Imaging of VEGFR-2 Expression in Lung Cancer with 64Cu-Labeled Ramucirumab.
26510548 2015 Hypoxic-ischemic gene expression profile in the isolated variant of biliary atresia.
26476544 2016 Association of Vascular Endothelial Growth Factor A (VEGFA) and its Receptor (VEGFR2) Gene Polymorphisms with Risk of Chronic Myeloid Leukemia and Influence on Clinical Outcome.
26459253 2016 VEGFR2 inhibition by RNA interference affects cell proliferation, migration, invasion, and response to radiation in Calu-1 cells.
26375674 2015 Pretreatment with VEGF(R)-inhibitors reduces interstitial fluid pressure, increases intraperitoneal chemotherapy drug penetration, and impedes tumor growth in a mouse colorectal carcinomatosis model.
26345385 2015 Overexpression of miRNA-497 inhibits tumor angiogenesis by targeting VEGFR2.
26337470 2015 Genetic interaction of P2X7 receptor and VEGFR-2 polymorphisms identifies a favorable prognostic profile in prostate cancer patients.
26325365 2015 Anticancer activity of TTAC-0001, a fully human anti-vascular endothelial growth factor receptor 2 (VEGFR-2/KDR) monoclonal antibody, is associated with inhibition of tumor angiogenesis.
26298629 2015 VEGFR2 predicts decreased patients survival in soft tissue sarcomas.
26268996 2015 Stromal expression of VEGF-A and VEGFR-2 in prostate tissue is associated with biochemical and clinical recurrence after radical prostatectomy.
26259755 2015 Serum VEGF-A and Tumor Vessel VEGFR-2 Levels Predict Survival in Caucasian but Not Asian Patients Undergoing Resection for Gastric Adenocarcinoma.
26254223 2015 Curcumin inhibits angiogenesis and improves defective hematopoiesis induced by tumor-derived VEGF in tumor model through modulating VEGF-VEGFR2 signaling pathway.
26211596 2015 Receptors for advanced glycation end products (RAGE) is associated with microvessel density and is a prognostic biomarker for clear cell renal cell carcinoma.
26199386 2015 Serum C-Telopeptide Collagen Crosslinks and Plasma Soluble VEGFR2 as Pharmacodynamic Biomarkers in a Trial of Sequentially Administered Sunitinib and Cilengitide.
26191229 2015 Up-regulation of VEGF and its receptor in refractory leukemia cells.
26174951 2015 SIRT1 mediated inhibition of VEGF/VEGFR2 signaling by Resveratrol and its relevance to choroidal neovascularization.
26169036 2015 Inhibition of MAPK and VEGFR by Sorafenib Controls the Progression of Endometriosis.
26137585 2015 MET Suppresses Epithelial VEGFR2 via Intracrine VEGF-induced Endoplasmic Reticulum-associated Degradation.
26126033 2015 VEGF and VEGFR2 in dentigerous cysts associated with impacted third molars.
26080815 2015 Mutant p53 cooperates with the SWI/SNF chromatin remodeling complex to regulate VEGFR2 in breast cancer cells.
26059764 2015 Hypoxia-induced expression of phosducin-like 3 regulates expression of VEGFR-2 and promotes angiogenesis.
26028346 2015 VEGFR2 Gene Polymorphisms and Response to Anti-Vascular Endothelial Growth Factor Therapy in Age-Related Macular Degeneration.
26021863 2015 Decreased expression of CHIP leads to increased angiogenesis via VEGF-VEGFR2 pathway and poor prognosis in human renal cell carcinoma.
26021484 2015 Molecularly Targeted Therapy of Human Hepatocellular Carcinoma Xenografts with Radio-iodinated Anti-VEGFR2 Murine-Human Chimeric Fab.
26014518 2015 Gab1 regulates proliferation and migration through the PI3K/Akt signaling pathway in intrahepatic cholangiocarcinoma.
25986862 2015 Biphasic effect of PTK7 on KDR activity in endothelial cells and angiogenesis.
25979342 2015 Synergistic Binding of Vascular Endothelial Growth Factor-A and Its Receptors to Heparin Selectively Modulates Complex Affinity.
25978354 2015 Corosolic Acid Inhibits Hepatocellular Carcinoma Cell Migration by Targeting the VEGFR2/Src/FAK Pathway.
25976977 2015 Expression and prognostic significance of VEGFR-2 in breast cancer.
25971967 2015 Transient Receptor Potential Canonical 1 (TRPC1) Channels as Regulators of Sphingolipid and VEGF Receptor Expression: IMPLICATIONS FOR THYROID CANCER CELL MIGRATION AND PROLIFERATION.
25970161 2015 VEGF and its receptors in dengue virus infection.
25967108 2015 The relevance of cell type- and tumor zone-specific VEGFR-2 activation in locally advanced colon cancer.
25948043 2015 Recombinant pigment epithelium-derived factor PEDF binds vascular endothelial growth factor receptors 1 and 2.
25909285 2015 Foretinib inhibits angiogenesis, lymphangiogenesis and tumor growth of pancreatic cancer in vivo by decreasing VEGFR-2/3 and TIE-2 signaling.
25896473 CTLA4-Ig/CD86 interactions in cultured human endothelial cells: effects on VEGFR-2 and ICAM1 expression.
25895461 2015 VEGFR1 and VEGFR2 in lip carcinogenesis and its association with microvessel density.
25883000 2015 Vascular endothelial growth factor receptor isoforms: are they present in oral squamous cell carcinoma?
25878330 2015 Direct Evidence of Target Inhibition with Anti-VEGF, EGFR, and mTOR Therapies in a Clinical Model of Wound Healing.
25872462 2015 Circulating endothelial progenitor cells and angiogenic factors in diabetes complicated diabetic foot and without foot complications.
25825981 2015 EMMPRIN/CD147 is a novel coreceptor of VEGFR-2 mediating its activation by VEGF.
25810250 2015 Gremlin regulates renal inflammation via the vascular endothelial growth factor receptor 2 pathway.
25787923 2015 Phase I study of every 2- or 3-week dosing of ramucirumab, a human immunoglobulin G1 monoclonal antibody targeting the vascular endothelial growth factor receptor-2 in patients with advanced solid tumors.
25775978 2015 Single chain precursor prohaptoglobin promotes angiogenesis by upregulating expression of vascular endothelial growth factor (VEGF) and VEGF receptor2.
25756047 2015 Analysis of circulating vascular endothelial growth factor and its soluble receptors in patients with different forms of chronic urticaria.
25754303 2015 Heparanase released from mesenchymal stem cells activates integrin beta1/HIF-2alpha/Flk-1 signaling and promotes endothelial cell migration and angiogenesis.
25713439 2015 Lessons from anti-vascular endothelial growth factor and anti-vascular endothelial growth factor receptor trials in patients with glioblastoma.
25707392 2015 Genetic variations in the VEGF pathway as prognostic factors in metastatic colorectal cancer patients treated with oxaliplatin-based chemotherapy.
25698653 2015 Peptide Lv augments L-type voltage-gated calcium channels through vascular endothelial growth factor receptor 2 (VEGFR2) signaling.
25682871 2015 Glioma cell VEGFR-2 confers resistance to chemotherapeutic and antiangiogenic treatments in PTEN-deficient glioblastoma.
25560472 2015 Prognostic and predictive role of vascular endothelial growth factor polymorphisms in breast cancer.
25550804 2014 VEGF/VEGFR2 and PDGF-B/PDGFR-? expression in non-metastatic renal cell carcinoma: a retrospective study in 1,091 consecutive patients.
25521758 2015 Mixl1 and Flk1 Are Key Players of Wnt/TGF-? Signaling During DMSO-Induced Mesodermal Specification in P19 cells.
25521357 2014 Pharmacogenetic interaction analysis of VEGFR-2 and IL-8 polymorphisms in advanced breast cancer patients treated with paclitaxel and bevacizumab.
25501707 2015 Knockdown of the AKT3 (PKB?), PI3KCA, and VEGFR2 genes by RNA interference suppresses glioblastoma multiforme T98G cells invasiveness in vitro.
25488616 2015 Clinical relevance of vascular endothelial growth factor type A (VEGFA) and VEGF receptor type 2 (VEGFR2) gene polymorphism in chronic lymphocytic leukemia.
25471788 2015 Peroxiredoxin 2 is involved in vasculogenic mimicry formation by targeting VEGFR2 activation in colorectal cancer.
25441661 2014 Increased VEGFR2 and MMP9 protein levels are associated with epithelial dysplasia grading.
25411163 2015 Identification of a variant in KDR associated with serum VEGFR2 and pharmacodynamics of Pazopanib.
25399804 2015 VEGFR signaling during lymphatic vascular development: From progenitor cells to functional vessels.
25387128 2014 N-terminal cleavage and release of the ectodomain of Flt1 is mediated via ADAM10 and ADAM 17 and regulated by VEGFR2 and the Flt1 intracellular domain.
25378411 2015 Plasminogen activator inhibitor-1 inhibits angiogenic signaling by uncoupling vascular endothelial growth factor receptor-2-?V?3 integrin cross talk.
25372416 2014 Inverse correlation of phospho-KDR/Flk-1 expression and stage of colorectal cancer: implication of the significance of neoangiogenesis in activated VEGFR-2 expressing early stage colorectal adenocarcinomas.
25354586 2015 Carbon monoxide inhibits sprouting angiogenesis and vascular endothelial growth factor receptor-2 phosphorylation.
25353068 2014 VEGF???-conjugated mesoporous silica nanoparticle: a tumor targeted drug delivery system.
25340839 2014 The inhibition of tyrosine kinase receptor signalling in leiomyosarcoma cells using the small molecule kinase inhibitor PTK787/ZK222584 (Vatalanib®).
25331892 2014 VEGF-induced neoangiogenesis is mediated by NAADP and two-pore channel-2-dependent Ca2+ signaling.
25329517 2014 Angiogenesis interactome and time course microarray data reveal the distinct activation patterns in endothelial cells.
25322777 2014 Flk-1/KDR mediates ethanol-stimulated endothelial cell Notch signaling and angiogenic activity.
25293577 2015 Comparison of tyrosine kinase receptors HER2, EGFR, and VEGFR expression in micropapillary urothelial carcinoma with invasive urothelial carcinoma.
25269419 2014 Fully human VEGFR2 monoclonal antibody BC001 attenuates tumor angiogenesis and inhibits tumor growth.
25261665 Regulatory roles of KDR antisense oligonucleotide on the proliferation of human prostate cancer cell line PC-3.
25245329 2014 Serum angiopoietin-2 and soluble VEGFR-2 levels predict malignancy of ovarian neoplasm and poor prognosis in epithelial ovarian cancer.
25217984 2014 Elevated microRNA-185 is associated with high vascular endothelial growth factor receptor 2 expression levels and high microvessel density in clear cell renal cell carcinoma.
25217645 2014 GPR126 protein regulates developmental and pathological angiogenesis through modulation of VEGFR2 receptor signaling.
25192841 2015 Effects of low level laser therapy on attachment, proliferation, and gene expression of VEGF and VEGF receptor 2 of adipocyte-derived mesenchymal stem cells cultivated under nutritional deficiency.
25182707 2014 The relationship of kinase insert domain receptor gene polymorphisms and clinical outcome in advanced hepatocellular carcinoma patients treated with sorafenib.
25182240 2014 Downregulation of KDR expression induces apoptosis in breast cancer cells.
25147336 2014 Nucleoside diphosphate kinase B regulates angiogenesis through modulation of vascular endothelial growth factor receptor type 2 and endothelial adherens junction proteins.
25128838 2014 Minor association of kinase insert domain-containing receptor gene polymorphism (rs2071559) with myocardial infarction in Caucasians with type 2 diabetes mellitus: case-control cross-sectional study.
25128562 2014 KIF13B regulates angiogenesis through Golgi to plasma membrane trafficking of VEGFR2.
25123269 2014 Genetic variants in the KDR gene is associated with the prognosis of transarterial chemoembolization treated hepatocellular carcinoma.
25114179 2014 Functional and structural characterization of the kinase insert and the carboxy terminal domain in VEGF receptor 2 activation.
25111568 2014 The association of genes involved in the angiogenesis-associated signaling pathway with risk of anterior cruciate ligament rupture.
25111127 2014 Dioscin inhibits colon tumor growth and tumor angiogenesis through regulating VEGFR2 and AKT/MAPK signaling pathways.
25025175 2014 The three receptor tyrosine kinases c-KIT, VEGFR2 and PDGFR?, closely spaced at 4q12, show increased protein expression in triple-negative breast cancer.
24982127 2014 PTP1b is a physiologic regulator of vascular endothelial growth factor signaling in endothelial cells.
24952732 2014 The antihypertension drug doxazosin inhibits tumor growth and angiogenesis by decreasing VEGFR-2/Akt/mTOR signaling and VEGF and HIF-1? expression.
24952635 2014 Thioridazine inhibits angiogenesis and tumor growth by targeting the VEGFR-2/PI3K/mTOR pathway in ovarian cancer xenografts.
24903995 2014 A preliminary evaluation of VEGF-A, VEGFR1 and VEGFR2 in patients with well-controlled type 2 diabetes mellitus.
24886133 2014 Kinase insert domain receptor/vascular endothelial growth factor receptor 2 (KDR) genetic variation is associated with ovarian hyperstimulation syndrome.
24880751 2015 Role of VEGF and VEGFR2 Receptor in Reversal of ALS-CSF Induced Degeneration of NSC-34 Motor Neuron Cell Line.
24845798 2014 Expression profiling and significance of VEGF-A, VEGFR2, VEGFR3 and related proteins in endometrial carcinoma.
24738074 2014 Role of plasma membrane caveolae/lipid rafts in VEGF-induced redox signaling in human leukemia cells.
24713547 2014 Explorative investigation of vascular endothelial growth factor receptor expression in primary ovarian cancer and its clinical relevance.
24687381 2014 Associations of VEGF and VEGFR2 polymorphisms with increased risk and aggressiveness of multiple myeloma.
24675699 2014 Role of VEGF-A and its receptors in sporadic and MEN2-associated pheochromocytoma.
24652518 2014 VEGFA and VEGFR2 gene polymorphisms and response to anti-vascular endothelial growth factor therapy: comparison of age-related macular degeneration treatments trials (CATT).
24641672 2014 Heparin binding VEGF isoforms attenuate hyperoxic embryonic lung growth retardation via a FLK1-neuropilin-1-PKC dependent pathway.
24633336 2014 P53, hTERT, WT-1, and VEGFR2 are the most suitable targets for cancer vaccine therapy in HLA-A24 positive pancreatic adenocarcinoma.
24620033 2014 Reversible acetylation regulates vascular endothelial growth factor receptor-2 activity.
24585635 2014 ERK3 promotes endothelial cell functions by upregulating SRC-3/SP1-mediated VEGFR2 expression.
24568071 2012 Association and interaction effect between VEGF receptor-2 (VEGFR-2) gene polymorphisms and dietary pattern on blood uric acid in Malays and Indians.
24529377 2014 Glycosylation-dependent lectin-receptor interactions preserve angiogenesis in anti-VEGF refractory tumors.
24522370 2014 Predictive value of VEGF A and VEGFR2 polymorphisms in the response to intravitreal ranibizumab treatment for wet AMD.
24521356 2014 Differential gene expression in Lin-/VEGF-R2+ bone marrow-derived endothelial progenitor cells isolated from diabetic mice.
24508097 2014 Increased placental angiogenesis in late and early onset pre-eclampsia is associated with differential activation of vascular endothelial growth factor receptor 2.
24442426 2014 Prognostic value of serum vascular endothelial growth factor receptor 2 response in patients with hepatocellular carcinoma undergoing transarterial chemoembolization.
24385342 2014 Glycaemic control improves perfusion recovery and VEGFR2 protein expression in diabetic mice following experimental PAD.
24365177 2014 Polymorphisms in vascular endothelial growth factor receptor 2 are associated with better response rates to ranibizumab treatment in age-related macular degeneration.
24341227 [Comparative immunohistochemical evaluation of vascular endothelial growth factor and its receptors in the placental villi in gestational diabetes mellitus and type 1 diabetes].
24335081 2014 Evidence for G-quadruplex in the promoter of vegfr-2 and its targeting to inhibit tumor angiogenesis.
24303885 2014 The role of VEGF and its receptors in the etiology of early pregnancy loss.
24300896 2013 Lysine methylation promotes VEGFR-2 activation and angiogenesis.
24296159 2014 VEGF165 modulates proliferation, adhesion, migration and differentiation of cultured human outer root sheath cells from central hair follicle epithelium through VEGFR-2 activation in vitro.
24260556 2013 Attenuation of VEGFR-2 expression by sFlt-1 and low oxygen in human placenta.
24184958 2014 A new chemical probe for quantitative proteomic profiling of fibroblast growth factor receptor and its inhibitors.
24170768 2014 Hypoxia-regulated overexpression of soluble VEGFR2 controls angiogenesis and inhibits tumor growth.
24123039 2013 Effects of single nucleotide polymorphisms on treatment outcomes and toxicity in patients treated with sunitinib.
24120473 2014 Autocrine VEGF signaling promotes proliferation of neoplastic Barrett's epithelial cells through a PLC-dependent pathway.
23990986 2013 Distinct phenotypic differences associated with differential amplification of receptor tyrosine kinase genes at 4q12 in glioblastoma.
23979202 Association between baseline VEGF/sVEGFR-2 and VEGF/TSP-1 ratios and response to metronomic chemotherapy using cyclophosphamide and celecoxib in patients with advanced breast cancer.
23972086 2013 Aqueous soluble vascular endothelial growth factor receptor-2 in macular edema with branch retinal vein occlusion.
23971975 2013 VEGF A (rs699947 and rs833061) and VEGFR2 (rs2071559) gene polymorphisms are not associated with AMD susceptibility in a Spanish population.
23934537 2013 CXCR4+ and FLK-1+ identify circulating cells associated with improved cardiac function in patients following myocardial infarction.
23861747 2013 Prospective validation of candidate SNPs of VEGF/VEGFR pathway in metastatic colorectal cancer patients treated with first-line FOLFIRI plus bevacizumab.
23831629 2013 Aberrant, ectopic expression of VEGF and VEGF receptors 1 and 2 in malignant colonic epithelial cells. Implications for these cells growth via an autocrine mechanism.
23799140 2013 VEGFR1 and VEGFR2 involvement in extracellular galectin-1- and galectin-3-induced angiogenesis.
23798385 2013 Decorin causes autophagy in endothelial cells via Peg3.
23794399 2014 VEGFA, FLT1, KDR and colorectal cancer: assessment of disease risk, tumor molecular phenotype, and survival.
23792958 2013 Identification of PDCL3 as a novel chaperone protein involved in the generation of functional VEGF receptor 2.
23772669 2014 Prognostic significance of immunohistochemical expression of the angiogenic molecules vascular endothelial growth factor-A, vascular endothelial growth factor receptor-1 and vascular endothelial growth factor receptor-2 in patients with classical Hodgkin lymphoma.
23771478 2013 Isolation and characterization of mouse bone marrow-derived Lin?/VEGF-R2? progenitor cells.
23759331 2013 Glucose-regulated protein 78 silencing down-regulates vascular endothelial growth factor/vascular endothelial growth factor receptor 2 pathway to suppress human colon cancer tumor growth.
23754286 2013 Lactate engages receptor tyrosine kinases Axl, Tie2, and vascular endothelial growth factor receptor 2 to activate phosphoinositide 3-kinase/Akt and promote angiogenesis.
23749886 2013 Expression of VEGF and its receptors VEGFR1/VEGFR2 is associated with invasiveness of bladder cancer.
23746980 2013 KDR identifies a conserved human and murine hepatic progenitor and instructs early liver development.
23723256 2013 Androgen receptor promotes sex-independent angiogenesis in response to ischemia and is required for activation of vascular endothelial growth factor receptor signaling.
23709605 2013 Domain 2 of uPAR regulates single-chain urokinase-mediated angiogenesis through ?1-integrin and VEGFR2.
23708980 2013 Mitochondrial UQCRB regulates VEGFR2 signaling in endothelial cells.
23697367 2013 A microRNA signature defines chemoresistance in ovarian cancer through modulation of angiogenesis.
23688497 2013 MicroRNA-15b contributes to ginsenoside-Rg1-induced angiogenesis through increased expression of VEGFR-2.
23685409 2013 Neuropilin-1 expression promotes invasiveness of melanoma cells through vascular endothelial growth factor receptor-2-dependent and -independent mechanisms.
23684887 2013 Decursin inhibited proliferation and angiogenesis of endothelial cells to suppress diabetic retinopathy via VEGFR2.
23636508 2013 The enzymatic activity of the VEGFR2 receptor for the biosynthesis of dinucleoside polyphosphates.
23635398 2013 Association between genetic variants of the VEGFR-2 gene and the risk of developing endometriosis in Northern Chinese Women.
23624620 2013 Microvessel density and expression of vascular endothelial growth factor and its receptors in different subtypes of primary cutaneous B-cell lymphoma.
23620752 2013 The diminished expression of proangiogenic growth factors and their receptors in gastric ulcers of cirrhotic patients.
23609797 2013 Hypertensive stretch regulates endothelial exocytosis of Weibel-Palade bodies through VEGF receptor 2 signaling pathways.
23583911 2013 Design, synthesis and biological evaluation of new classes of thieno[3,2-d]pyrimidinone and thieno[1,2,3]triazine as inhibitor of vascular endothelial growth factor receptor-2 (VEGFR-2).
23583373 2013 Early VEGFR2 activation in response to flow is VEGF-dependent and mediated by MMP activity.
23555666 2013 The decrease of mineralcorticoid receptor drives angiogenic pathways in colorectal cancer.
23551429 2014 Clinical significance of vascular endothelial growth factor and vascular endothelial growth factor receptor-2 gene polymorphisms in patients with gastrointestinal stromal tumors.
23548264 2013 A novel inhibitor of c-Met and VEGF receptor tyrosine kinases with a broad spectrum of in vivo antitumor activities.
23536763 2013 Vascular endothelial growth factor receptor 2 (VEGFR-2) plays a key role in vasculogenic mimicry formation, neovascularization and tumor initiation by Glioma stem-like cells.
23533349 2013 VEGF promotes proliferation of human glioblastoma multiforme stem-like cells through VEGF receptor 2.
23529610 2013 Vascular endothelial cell growth-activated XBP1 splicing in endothelial cells is crucial for angiogenesis.
23516476 2013 Klotho endows hepatoma cells with resistance to anoikis via VEGFR2/PAK1 activation in hepatocellular carcinoma.
23511629 2013 VEGF and VEGFR polymorphisms affect clinical outcome in advanced renal cell carcinoma patients receiving first-line sunitinib.
23475388 2013 Expression of vascular endothelial growth factor (VEGF) and its receptors VEGFR1 and VEGFR2 in primary and recurrent WHO grade III meningiomas.
23454747 2013 Tumor VEGF:VEGFR2 autocrine feed-forward loop triggers angiogenesis in lung cancer.
23424651 2013 COSMC is overexpressed in proliferating infantile hemangioma and enhances endothelial cell growth via VEGFR2.
23418605 2013 Insulin-like growth factor receptor I (IGF-IR) and vascular endothelial growth factor receptor 2 (VEGFR-2) are expressed on the circulating epithelial tumor cells of breast cancer patients.
23400753 2013 The soluble VEGF receptor 1 and 2 expression in cerebral spinal fluid as an indicator for leukemia central nervous system metastasis.
23397142 2013 Analysis of protein-protein interactions in cross-talk pathways reveals CRKL protein as a novel prognostic marker in hepatocellular carcinoma.
23393387 2013 Thioredoxin-interacting protein mediates sustained VEGFR2 signaling in endothelial cells required for angiogenesis.
23393131 2013 Endothelial cell-specific chemotaxis receptor (ECSCR) enhances vascular endothelial growth factor (VEGF) receptor-2/kinase insert domain receptor (KDR) activation and promotes proteolysis of internalized KDR.
23392734 2013 Altered expression of endogenous soluble vascular endothelial growth factor receptor-2 is involved in the progression of esophageal squamous cell carcinoma.
23376830 2013 Endothelial cell-by-cell profiling reveals the temporal dynamics of VEGFR1 and VEGFR2 membrane localization after murine hindlimb ischemia.
23376569 2014 Overexpression of vascular endothelial growth factor receptor 2 in pterygia may have a predictive value for a higher postoperative recurrence rate.
23374253 2013 Endorepellin laminin-like globular 1/2 domains bind Ig3-5 of vascular endothelial growth factor (VEGF) receptor 2 and block pro-angiogenic signaling by VEGFA in endothelial cells.
23370473 2013 Human papillomavirus, p16, and epidermal growth factor receptor biomarkers and CT perfusion values in head and neck squamous cell carcinoma.
23363445 2013 Norcantharidin inhibits tumor angiogenesis via blocking VEGFR2/MEK/ERK signaling pathways.
23348691 2013 Brucine, an indole alkaloid from Strychnos nux-vomica attenuates VEGF-induced angiogenesis via inhibiting VEGFR2 signaling pathway in vitro and in vivo.
23341459 2013 Essential role for endocytosis in the growth factor-stimulated activation of ERK1/2 in endothelial cells.
23331867 2013 Vascular endothelial-cadherin stimulates syndecan-1-coupled insulin-like growth factor-1 receptor and cross-talk between ?V?3 integrin and vascular endothelial growth factor receptor 2 at the onset of endothelial cell dissemination during angiogenesis.
23293110 2013 VEGFR-2, CXCR-2 and PAR-1 germline polymorphisms as predictors of survival in pancreatic carcinoma.
23273598 2013 Correlation between VEGFR-2 receptor kinase domain-containing receptor (KDR) mRNA and angiotensin II receptor type 1 (AT1-R) mRNA in endometrial cancer.
23262137 2013 The myosin motor Myo1c is required for VEGFR2 delivery to the cell surface and for angiogenic signaling.
23258273 2013 MiR-17-3p inhibits angiogenesis by downregulating flk-1 in the cell growth signal pathway.
23254951 2013 Jiedu Xiaozheng Yin, a Chinese herbal formula, inhibits tumor angiogenesis via downregulation of VEGF-A and VEGFR-2 expression in vivo and in vitro.
23250775 2013 Long-term follow-up of immunocytochemical analysis of vascular endothelial growth factor (VEGF), and its two receptors, VEGF-R1 (Flt-1) and VEGF-R2 (Flk-1/KDR), in oesophagogastric cancer.
23221067 2013 Expression of vascular endothelial growth factor in eyes with Coats' disease.
23202541 2013 Intratumoral FOXP3+VEGFR2+ regulatory T cells are predictive markers for recurrence and survival in patients with colorectal cancer.
23199280 2013 VEGFR2 functions as an H2S-targeting receptor protein kinase with its novel Cys1045-Cys1024 disulfide bond serving as a specific molecular switch for hydrogen sulfide actions in vascular endothelial cells.
23174599 2012 [Role of Ang-2, Tie-2 and VEGFR-2 in angiogenesis in colorectal carcinoma and their prognostic value].
23172303 2013 Vascular endothelial growth factor and its receptor system: physiological functions in angiogenesis and pathological roles in various diseases.
23171577 2013 Quantification of circulating CD34+/KDR+/CD45dim endothelial progenitor cells: analytical considerations.
23169005 2013 Association of VEGF and KDR single nucleotide polymorphisms with colorectal cancer susceptibility in Koreans.
23158831 2013 Association of kinase insert domain-containing receptor (KDR) gene polymorphisms with idiopathic recurrent spontaneous abortion in Korean women.
23155052 2013 Matrix metalloproteinase-1-mediated up-regulation of vascular endothelial growth factor-2 in endothelial cells.
23151382 2013 Pre-B cell colony enhancing factor (PBEF/NAMPT/Visfatin) and vascular endothelial growth factor (VEGF) cooperate to increase the permeability of the human placental amnion.
23146028 2012 PDGFR?/? and VEGFR2 polymorphisms in colorectal cancer: incidence and implications in clinical outcome.
23139789 2012 A heat-shock protein axis regulates VEGFR2 proteolysis, blood vessel development and repair.
23111153 Implication of VEGFR2 in systemic lupus erythematosus: a combined genetic and structural biological approach.
23077562 2012 The role of VEGF and KDR polymorphisms in moyamoya disease and collateral revascularization.
23060442 2012 Endorepellin affects angiogenesis by antagonizing diverse vascular endothelial growth factor receptor 2 (VEGFR2)-evoked signaling pathways: transcriptional repression of hypoxia-inducible factor 1? and VEGFA and concurrent inhibition of nuclear factor of activated T cell 1 (NFAT1) activation.
23059888 2012 Expression and localization of VEGF receptors in human fetal skeletal tissues.
23038639 2013 Differential expression of VEGF ligands and receptors in prostate cancer.
23030506 2012 Single nucleotide polymorphism and serum levels of VEGFR2 are associated with age related macular degeneration.
22997228 2013 Dual suppression of hemangiogenesis and lymphangiogenesis by splice-shifting morpholinos targeting vascular endothelial growth factor receptor 2 (KDR).
22975327 2012 The sphingosine-1-phosphate receptor S1PR1 restricts sprouting angiogenesis by regulating the interplay between VE-cadherin and VEGFR2.
22965144 2012 Formation of the collateral circulation is regulated by vascular endothelial growth factor-A and a disintegrin and metalloprotease family members 10 and 17.
22956423 2013 ??-glycoprotein I inhibits VEGF-induced endothelial cell growth and migration via suppressing phosphorylation of VEGFR2, ERK1/2, and Akt.
22955733 2012 MicroRNA-10 regulates the angiogenic behavior of zebrafish and human endothelial cells by promoting vascular endothelial growth factor signaling.
22897854 2012 Targeted disruption of heparan sulfate interaction with hepatocyte and vascular endothelial growth factors blocks normal and oncogenic signaling.
22828632 2012 The role of heterodimerization between VEGFR-1 and VEGFR-2 in the regulation of endothelial cell homeostasis.
22789536 2012 VEGF inhibits tumor cell invasion and mesenchymal transition through a MET/VEGFR2 complex.
22772062 2012 Cyclin I correlates with VEGFR-2 and cell proliferation in human epithelial ovarian cancer.
22763125 2012 Tyrosine phosphatase PTP-MEG2 negatively regulates vascular endothelial growth factor receptor signaling and function in endothelial cells.
22730813 2012 [Significance and expression of VEGF and its receptor in nasal inverted papillomas and the correlation with malignant phenotype].
22723445 2012 Liver X receptor activation reduces angiogenesis by impairing lipid raft localization and signaling of vascular endothelial growth factor receptor-2.
22718841 2012 CD146 is a coreceptor for VEGFR-2 in tumor angiogenesis.
22711876 2012 SCF(?-TRCP) suppresses angiogenesis and thyroid cancer cell migration by promoting ubiquitination and destruction of VEGF receptor 2.
22710795 2012 FAS1 domain protein inhibits VEGF165-induced angiogenesis by targeting the interaction between VEGFR-2 and ?v?3 integrin.
22707264 2012 Lycopene inhibits angiogenesis both in vitro and in vivo by inhibiting MMP-2/uPA system through VEGFR2-mediated PI3K-Akt and ERK/p38 signaling pathways.
22706170 2012 Characterization and comparison of embryonic stem cell-derived KDR+ cells with endothelial cells.
22690749 2012 Expression of vascular endothelial growth factor and vascular endothelial growth factor receptors 1 and 2 in invasive breast carcinoma: prognostic significance and relationship with markers for aggressiveness.
22659165 2012 VEGF induces proliferation of human hair follicle dermal papilla cells through VEGFR-2-mediated activation of ERK.
22654102 2012 Glioblastoma-derived tumor cells induce vasculogenic mimicry through Flk-1 protein activation.
22592917 2012 c-Jun N-terminal kinase mediated VEGFR2 sustained phosphorylation is critical for VEGFA-induced angiogenesis in vitro and in vivo.
22587628 2012 Increased risk of ovarian hyperstimulation syndrome following controlled ovarian hyperstimulation in patients with vascular endothelial growth factor +405 cc genotype.
22553146 2013 Advanced glycation end product N?-carboxymethyllysine induces endothelial cell injury: the involvement of SHP-1-regulated VEGFR-2 dephosphorylation.
22542663 2012 Tubular network formation by adriamycin-resistant MCF-7 breast cancer cells is closely linked to MMP-9 and VEGFR-2/VEGFR-3 over-expressions.
22541785 Microvascularization and expression of VEGF and its receptors in recurring meningiomas: pathobiological data in favor of anti-angiogenic therapy approaches.
22541078 2012 [Effect of berberine on HL-60 cell proliferation, apoptosis and vascular endothelial growth factor receptor 2 expression].
22539090 2013 Circulating vascular endothelial growth factor receptor 2/pAkt-positive cells as a functional pharmacodynamic marker in metastatic colorectal cancers treated with antiangiogenic agent.
22528855 2012 Role and regulation of VEGF and its receptors 1 and 2 in the aseptic loosening of total hip implants.
22520092 2012 Association between kinase insert domain-containing receptor gene polymorphisms and silent brain infarction: a Korean study.
22510937 2012 Association between kinase insert domain-containing receptor polymorphisms (-604T>C, 1192G>A, 1719A>T) and premature ovarian failure in Korean women.
22507619 2012 Association and interaction between dietary pattern and VEGF receptor-2 (VEGFR2) gene polymorphisms on blood lipids in Chinese Malaysian and Japanese adults.
22473693 2012 The lymphangiogenesis inhibitor esVEGFR-2 in human embryos: expression in sympatho-adrenal tissues and differentiation-induced up-regulation in neuroblastoma.
22426130 2012 PDGF-induced migration of vascular smooth muscle cells is inhibited by heme oxygenase-1 via VEGFR2 upregulation and subsequent assembly of inactive VEGFR2/PDGFR? heterodimers.
22407444 2012 Dysregulation of the ?3 integrin-VEGFR2 complex in Hantaan virus-directed hyperpermeability upon treatment with VEGF.
22404826 2012 Possible genetic predisposition to lymphedema after breast cancer.
22395975 2012 Vascular endothelial growth factor receptor 2 gene polymorphisms as predictors for tumor recurrence and overall survival in non-small-cell lung cancer.
22393126 2012 Autocrine VEGF-VEGFR2-Neuropilin-1 signaling promotes glioma stem-like cell viability and tumor growth.
22386962 2012 Placental expression of VEGF family mRNA in adverse pregnancy outcomes.
22344734 2012 Single-nucleotide polymorphisms in the KDR gene in pregnancies complicated by gestational hypertensive disorders and small-for-gestational-age infants.
22327338 2012 c-ABL modulates MAP kinases activation downstream of VEGFR-2 signaling by direct phosphorylation of the adaptor proteins GRB2 and NCK1.
22314185 2012 Vascular endothelial growth factor receptor 2 as a marker for malignant vascular tumors and mesothelioma: an immunohistochemical study of 262 vascular endothelial and 1640 nonvascular tumors.
22303475 2012 A role for VEGFR2 activation in endothelial responses caused by barrier disruptive OxPAPC concentrations.
22301682 2011 Interaction between VEGF receptor-2 gene polymorphisms and dietary patterns on blood glucose and lipid levels in Chinese Malaysian adults.
22274884 2012 Association between genetic variations of vascular endothelial growth factor receptor 2 and glioma in the Chinese Han population.
22268049 2011 Vascular endothelial growth factor and type 2 receptor for this factor in vascular malformations.
22229497 2012 Insights into the conformational switching mechanism of the human vascular endothelial growth factor receptor type 2 kinase domain.
22227235 2012 Regulation of human thyroid follicular cell function by inhibition of vascular endothelial growth factor receptor signalling.
22208996 2012 Generation and characterization of a functional Nanobody against the vascular endothelial growth factor receptor-2; angiogenesis cell receptor.
22207738 2012 Thermodynamic and structural description of allosterically regulated VEGFR-2 dimerization.
22203933 2011 VEGFR1 and VEGFR2 immunohistochemical expression in oral squamous cell carcinoma: a morphometric study.
22203927 2011 VEGF and his R1 and R2 receptors expression in mast cells of oral squamous cells carcinomas and their involvement in tumoral angiogenesis.
22199315 2011 Correlation between IDH1 gene mutation status and survival of patients treated for recurrent glioma.
22184869 2011 Analysis of vascular distribution and growth factors in human gingival tissue associated with periodontal probing depth.
22182247 2012 Potentially functional genetic variants in KDR gene as prognostic markers in patients with resected colorectal cancer.
22174934 2011 Phosphorylation of Akt and ERK1/2 is required for VEGF-A/VEGFR2-induced proliferation and migration of lymphatic endothelium.
22170730 2012 Increased gene copy number of KIT and VEGFR2 at 4q12 in primary breast cancer is related to an aggressive phenotype and impaired prognosis.
22169262 2012 Design, synthesis and antitumor activity of 4-aminoquinazoline derivatives targeting VEGFR-2 tyrosine kinase.
22159994 2012 Hypoxia differentially regulates arterial and venous smooth muscle cell proliferation via PDGFR-? and VEGFR-2 expression.
22153185 2012 Absence of mutations in the activation loop and juxtamembrane domains of VEGFR-1 and VEGFR-2 gene in chronic myelomonocytic leukemia (CMML).
22129133 2012 VEGFA and VEGFR2 genetic polymorphisms and survival in patients with diffuse large B cell lymphoma.
22099303 2011 Peroxiredoxin II is an essential antioxidant enzyme that prevents the oxidative inactivation of VEGF receptor-2 in vascular endothelial cells.
22095860 2012 Vascular endothelial growth factor receptor 2 (VEGFR2, Flk-1/KDR) protects HEK293 cells against CoCl(2) -induced hypoxic toxicity.
22062947 2012 Activation of VEGFR-2 signaling in response to moderate dose of ultraviolet B promotes survival of normal human keratinocytes.
22038228 2011 Nephrotic syndrome unfavorable course correlates with downregulation of podocyte vascular endothelial growth factor receptor (VEGFR)-2.
22025615 2011 The antifungal drug itraconazole inhibits vascular endothelial growth factor receptor 2 (VEGFR2) glycosylation, trafficking, and signaling in endothelial cells.
22020326 2012 MULTIMERIN2 impairs tumor angiogenesis and growth by interfering with VEGF-A/VEGFR2 pathway.
22019447 2011 VEGFR2 signalling contributes to increased endothelial susceptibility to TNF-? under chronic non-uniform shear stress.
22016416 2012 Ovarian hyperstimulation syndrome is correlated with a reduction of soluble VEGF receptor protein level and a higher amount of VEGF-A.
22003972 2011 Effect of molecular imaging on validation of developed anti-hVEGFR2 therapeutic antibody.
22002459 2012 ARNO regulates VEGF-dependent tissue responses by stabilizing endothelial VEGFR-2 surface expression.
21985798 2011 VEGFR2 expression and TGF-? signaling in initial and recurrent high-grade human glioma.
21984395 2012 Phosphorylated pVEGFR2/KDR receptor expression in uveal melanomas: relation with HIF2? and survival.
21980525 2011 VEGFR2 translocates to the nucleus to regulate its own transcription.
21937609 2011 Glomerular endothelial PI3 kinase-? couples to VEGFR2, but is not required for eNOS activation.
21909756 2011 The patterns and expression of KDR in normal tissues of human internal organs.
21893193 2012 Programmed cell death 6 (PDCD6) inhibits angiogenesis through PI3K/mTOR/p70S6K pathway by interacting of VEGFR-2.
21885851 2011 MicroRNA-16 and microRNA-424 regulate cell-autonomous angiogenic functions in endothelial cells via targeting vascular endothelial growth factor receptor-2 and fibroblast growth factor receptor-1.
21882181 2012 Association of VEGF and VEGFR2 single nucleotide polymorphisms with hypertension and clinical outcome in metastatic clear cell renal cell carcinoma patients treated with sunitinib.
21867402 2012 Late-onset preeclampsia is associated with an imbalance of angiogenic and anti-angiogenic factors in patients with and without placental lesions consistent with maternal underperfusion.
21864059 2011 The CpG island methylation regulated expression of endothelial proangiogenic genes in response to ?-carotene and arachidonic acid.
21858086 2011 GEP100-Arf6-AMAP1-cortactin pathway frequently used in cancer invasion is activated by VEGFR2 to promote angiogenesis.
21849059 2011 Cytotoxicity of VEGF(121)/rGel on vascular endothelial cells resulting in inhibition of angiogenesis is mediated via VEGFR-2.
21827946 2011 The structural basis for the function of two anti-VEGF receptor 2 antibodies.
21827221 2011 Maternal plasma concentrations of angiogenic/anti-angiogenic factors are of prognostic value in patients presenting to the obstetrical triage area with the suspicion of preeclampsia.
21826315 2011 VEGF internalization is not required for VEGFR-2 phosphorylation in bioengineered surfaces with covalently linked VEGF.
21808992 2012 Circulating CD133(+)VEGFR2 (+) and CD34 (+)VEGFR2 (+) cells and arterial function in patients with beta-thalassaemia major.
21779435 2010 Tyrosine Kinase Receptor Flt/VEGFR Family: Its Characterization Related to Angiogenesis and Cancer.
21751212 2012 Expression of receptors for VEGFs on normal human thyroid follicular cells and their role in follicle formation.
21724587 2011 Increased VEGFR-2 gene copy is associated with chemoresistance and shorter survival in patients with non-small-cell lung carcinoma who receive adjuvant chemotherapy.
21715322 2011 Galectin-3 protein modulates cell surface expression and activation of vascular endothelial growth factor receptor 2 in human endothelial cells.
21712447 2011 Novel functional germline variants in the VEGF receptor 2 gene and their effect on gene expression and microvessel density in lung cancer.
21711246 2011 Signal transduction by vascular endothelial growth factor receptors.
21705026 2011 Association between kinase insert domain-containing receptor gene polymorphism and haplotypes and ischemic stroke.
21694464 2010 Diagnostic and prognostic tissuemarkers in clear cell and papillary renal cell carcinoma.
21692879 2011 Transplantation of Flk-1+ human bone marrow-derived mesenchymal stem cells promotes angiogenesis and neurogenesis after cerebral ischemia in rats.
21683519 2011 Differential dependency of human cancer cells on vascular endothelial growth factor-mediated autocrine growth and survival.
21680174 2011 RNAi-mediated silencing of VEGF-C inhibits non-small cell lung cancer progression by simultaneously down-regulating the CXCR4, CCR7, VEGFR-2 and VEGFR-3-dependent axes-induced ERK, p38 and AKT signalling pathways.
21671140 2012 Immunohistochemical study of the angiogenetic network of VEGF, HIF1?, VEGFR-2 and endothelial nitric oxide synthase (eNOS) in human breast cancer.
21667138 2011 A cell penetrating peptide derived from azurin inhibits angiogenesis and tumor growth by inhibiting phosphorylation of VEGFR-2, FAK and Akt.
21659473 2011 Decorin is a novel VEGFR-2-binding antagonist for the human extravillous trophoblast.
21658307 Anti-TNF-alpha antibody (infliximab) therapy supports the recovery of eNOS and VEGFR2 protein expression in endothelial cells.
21653826 2011 VEGF binding to NRP1 is essential for VEGF stimulation of endothelial cell migration, complex formation between NRP1 and VEGFR2, and signaling via FAK Tyr407 phosphorylation.
21636804 2011 Thioredoxin-interacting protein mediates TRX1 translocation to the plasma membrane in response to tumor necrosis factor-?: a key mechanism for vascular endothelial growth factor receptor-2 transactivation by reactive oxygen species.
21635552 2011 Prognostic significance of epidermal growth factor receptor and vascular endothelial growth factor receptor in colorectal adenocarcinoma.
21605611 2011 Concomitant vascular GRP-receptor and VEGF-receptor expression in human tumors: molecular basis for dual targeting of tumoral vasculature.
21599511 2011 Direct comparison of four adeno-associated virus serotypes in mediating the production of antiangiogenic proteins in mouse muscle.
21596751 2011 Endorepellin, the angiostatic module of perlecan, interacts with both the ?2?1 integrin and vascular endothelial growth factor receptor 2 (VEGFR2): a dual receptor antagonism.
21590454 2011 Clinically relevant biomarkers to select patients for targeted inhibitor therapy after resection of hepatocellular carcinoma.
21586748 2011 Neuropilin-1 promotes VEGFR-2 trafficking through Rab11 vesicles thereby specifying signal output.
21544626 2011 Regulation of vascular endothelial growth factor signaling by miR-200b.
21539813 2011 The VEGFR2 receptor tyrosine kinase undergoes constitutive endosome-to-plasma membrane recycling.
21524919 2011 DC electric stimulation upregulates angiogenic factors in endothelial cells through activation of VEGF receptors.
21498704 2011 Co-localization of prothrombin fragment F1+2 and VEGF-R2-bound VEGF in human colon cancer.
21481963 2011 Combined VEGF-A and VEGFR-2 concentrations in plasma: diagnostic and prognostic implications in patients with advanced NSCLC.
21478036 2013 Expression level of vascular endothelial growth factor receptor-2 in radical nephrectomy specimens as a prognostic predictor in patients with metastatic renal cell carcinoma treated with sunitinib.
21445972 2012 VEGF directly suppresses activation of T cells from ovarian cancer patients and healthy individuals via VEGF receptor Type 2.
21424032 2011 Expression of VEGF, VEGFR, EGFR, COX-2 and MVD in cervical carcinoma, in relation with the response to radio-chemotherapy.
21412269 2012 VEGF and its soluble receptor VEGFR-2 in hypertensive disorders during pregnancy: the Indian scenario.
21409488 2011 Contrasting prognostic implications of platelet-derived growth factor receptor-? and vascular endothelial growth factor receptor-2 in patients with angiosarcoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21402774 2011 PEST motif serine and tyrosine phosphorylation controls vascular endothelial growth factor receptor 2 stability and downregulation.
21396771 2011 Bronchial washing levels of vascular endothelial growth factor receptor-2 (VEGFR2) correlate with overall survival in NSCLC patients.
21389833 2011 VEGFR1 and PKC? signaling control melanoma vasculogenic mimicry in a VEGFR2 kinase-independent manner.
21388971 2011 An antibody targeted to VEGFR-2 Ig domains 4-7 inhibits VEGFR-2 activation and VEGFR-2-dependent angiogenesis without affecting ligand binding.
21382277 High articular levels of the angiogenetic factors VEGF and VEGF-receptor 2 as tissue healing biomarkers after single bundle anterior cruciate ligament reconstruction.
21382095 2011 Amplification of the PDGFRA, KIT and KDR genes in glioblastoma: a population-based study.
21343372 2011 Inhibition of prostate cancer osteoblastic progression with VEGF121/rGel, a single agent targeting osteoblasts, osteoclasts, and tumor neovasculature.
21303671 2011 Vascular-endothelial growth factor and its high affinity receptor VEGFR-2 in the normal versus destructive lesions human forebrain during development: an immuno-histochemical comparative study.
21257617 2011 Association of polymorphisms/haplotypes of the genes encoding vascular endothelial growth factor and its KDR receptor with recurrent pregnancy loss.
21220477 2011 Targeted therapy of VEGFR2 and EGFR significantly inhibits growth of anaplastic thyroid cancer in an orthotopic murine model.
21219538 2011 Reduced serum vascular endothelial growth factor receptor-2 (sVEGFR-2) and sVEGFR-1 levels in gastric cancer patients.
21208810 2011 Serum VEGF levels and tissue activation of VEGFR2/KDR receptors in patients with breast and gynecologic cancer.
21208252 2011 Vascular endothelial growth factor receptor 2 (VEGFR-2) signalling activity in paediatric pilocytic astrocytoma is restricted to tumour endothelial cells.
21191630 2011 Genetic variations in VEGF and VEGFR2 and glioblastoma outcome.
21190990 2011 Dentin matrix protein 1 induces membrane expression of VE-cadherin on endothelial cells and inhibits VEGF-induced angiogenesis by blocking VEGFR-2 phosphorylation.
21177802 2011 VEGFR2 and Src kinase inhibitors suppress Andes virus-induced endothelial cell permeability.
21173732 2010 Age-related changes in apoptosis and expressions of intercellular adhesion molecule-1 and vascular endothelial growth factor receptor type 2 in the wall of varicose veins.
21168388 2011 Hypoxia differentially regulates VEGFR1 and VEGFR2 levels and alters intracellular signaling and cell migration in endothelial cells.
21165437 2010 Vascular endothelial growth factor and its type 2 receptor in hepatocellular carcinoma.
21163065 2010 [Expression of VEGFR-2 and VEGFR-3 in papillary renal cell carcinoma and their relationship with prognosis].
21159176 2010 VEGFR2 heterogeneity and response to anti-angiogenic low dose metronomic cyclophosphamide treatment.
21131553 2011 Antitumor activity of BIBF 1120, a triple angiokinase inhibitor, and use of VEGFR2+pTyr+ peripheral blood leukocytes as a pharmacodynamic biomarker in vivo.
21130043 2010 Effective suppression of vascular network formation by combination of antibodies blocking VEGFR ligand binding and receptor dimerization.
21129272 2010 [Inhibition of vegfr-2 gene expression by RNA interference].
21098094 2010 VEGF receptor signaling links inflammation and tumorigenesis in colitis-associated cancer.
21084743 2010 Shear stress induces a transient and VEGFR-2-dependent decrease in the motion of injected particles in endothelial cells.
21063020 2011 Regulation of vascular endothelial growth factor receptor 2 trafficking and angiogenesis by Golgi localized t-SNARE syntaxin 6.
21062896 2010 MT1-MMP regulates VEGF-A expression through a complex with VEGFR-2 and Src.
21048041 2011 Pharmacogenetic interaction analysis for the efficacy of systemic treatment in metastatic colorectal cancer.
21047416 2010 Soluble perlecan domain I enhances vascular endothelial growth factor-165 activity and receptor phosphorylation in human bone marrow endothelial cells.
21041381 2011 Vascular endothelial growth factor (VEGF) and its receptor VEGFR-2 are highly expressed in ovarian granulosa cell tumors.
20963665 VEGFR-2 expression in tumor tissue of breast cancer patients.
20959405 2010 The IFNG (IFN-gamma) genotype predicts cytogenetic and molecular response to imatinib therapy in chronic myeloid leukemia.
20923780 2010 Thrombospondin-1 inhibits VEGF receptor-2 signaling by disrupting its association with CD47.
20854187 2010 Soluble receptors for vascular endothelial growth factor (sVEGFR1/sVEGFR2) in infantile hemangioma.
20851763 2011 Crosstalk between VEGFR2 and muscarinic receptors regulates the mTOR pathway in serum starved SK-N-SH human neuroblastoma cells.
20842453 2011 Vascular endothelial growth factor stimulates osteoblastic differentiation of cultured human periosteal-derived cells expressing vascular endothelial growth factor receptors.
20824203 2010 EMMPRIN promotes melanoma cells malignant properties through a HIF-2alpha mediated up-regulation of VEGF-receptor-2.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20716285 2010 Cigarette smoke-mediated oxidative stress, shear stress, and endothelial dysfunction: role of VEGFR2.
20706192 2011 Genetic variation of vascular endothelial growth factor pathway does not correlate with the severity of retinopathy of prematurity.
20705758 2011 Blood vessel endothelial VEGFR-2 delays lymphangiogenesis: an endogenous trapping mechanism links lymph- and angiogenesis.
20695190 2010 Prognostic significance of VEGF and its receptors in endometrioid endometrial cancer.
20686603 2010 The 4q12 amplicon in malignant peripheral nerve sheath tumors: consequences on gene expression and implications for sunitinib treatment.
20674013 2010 Vascular endothelial growth factor (VEGF) and VEGF-receptor expression in placenta of hyperglycemic pregnant women.
20660291 2010 Gremlin is a novel agonist of the major proangiogenic receptor VEGFR2.
20635108 2010 Expression of vascular endothelial growth factor receptor-1/-2 and nitric oxide in unruptured intracranial aneurysms.
20630084 2010 Hypertension and hand-foot skin reactions related to VEGFR2 genotype and improved clinical outcome following bevacizumab and sorafenib.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20615131 2010 Increased expression of vascular endothelial growth factor and its receptors, VEGFR-1 and VEGFR-2, in medullary thyroid carcinoma.
20606037 2010 Vascular endothelial growth factor receptors VEGFR-2 and VEGFR-3 are localized primarily to the vasculature in human primary solid cancers.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20548028 2010 Mechanical signals activate vascular endothelial growth factor receptor-2 to upregulate endothelial cell proliferation during inflammation.
20538805 2010 Effect of vascular endothelial growth factor and its receptor KDR on the transendothelial migration and local trafficking of human T cells in vitro and in vivo.
20529868 2010 Vascular endothelial growth factor receptor-2 activates ADP-ribosylation factor 1 to promote endothelial nitric-oxide synthase activation and nitric oxide release from endothelial cells.
20510958 2010 A decrease in maternal plasma concentrations of sVEGFR-2 precedes the clinical diagnosis of preeclampsia.
20501673 2010 S1P1 and VEGFR-2 form a signaling complex with extracellularly regulated kinase 1/2 and protein kinase C-alpha regulating ML-1 thyroid carcinoma cell migration.
20485168 2010 Inhibiting the VEGF-VEGFR pathway in angiosarcoma, epithelioid hemangioendothelioma, and hemangiopericytoma/solitary fibrous tumor.
20484670 2010 Soluble forms of VEGF receptor-1 and -2 promote vascular maturation via mural cell recruitment.
20473929 2011 VEGFR-2 expression in carcinoid cancer cells and its role in tumor growth and metastasis.
20471686 2010 Association of age-related macular degeneration with polymorphisms in vascular endothelial growth factor and its receptor.
20463083 2010 Pathogenic hantaviruses Andes virus and Hantaan virus induce adherens junction disassembly by directing vascular endothelial cadherin internalization in human endothelial cells.
20462514 2010 Vascular endothelial growth factor receptor-2 in breast cancer.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20446891 2010 A comprehensive study of the association between the EGFR and ERBB2 genes and glioma risk.
20395257 2010 Autocrine VEGF-VEGF-R loop on podocytes during glomerulonephritis in humans.
20389299 2010 Pazopanib-induced hyperbilirubinemia is associated with Gilbert's syndrome UGT1A1 polymorphism.
20388479 2010 [Effects of Radix Ginseng and Radix Notoginseng formula on secretion of vascular endothelial growth factor and expression of vascular endothelial growth factor receptor-2 in human umbilical vein endothelial cells].
20367641 2010 Significance of phospho-vascular endothelial growth factor receptor-2 expression in pancreatic cancer.
20360595 2010 Maternal circulating CD34+VEGFR-2+ and CD133+VEGFR-2+ progenitor cells increase during normal pregnancy but are reduced in women with preeclampsia.
20236940 2010 Activation of vascular endothelial growth factor receptor 2 in a cellular model of loricrin keratoderma.
20224550 2010 VEGF receptor 2/-3 heterodimers detected in situ by proximity ligation on angiogenic sprouts.
20222950 2010 Role of the VEGF ligand to receptor ratio in the progression of mismatch repair-proficient colorectal cancer.
20218294 2009 [The effects of ginsenosides Rg3 on the expressions of VEGF and KDR in human lung squamous cancer cells].
20215856 2010 Genetic association of angiogenesis- and hypoxia-related gene polymorphisms with osteonecrosis of the femoral head.
20195243 2010 Molecular blockade of VEGFR2 in human epithelial ovarian carcinoma cells.
20182906 2011 Influence of pharmacogenetic variability on the pharmacokinetics and toxicity of the aurora kinase inhibitor danusertib.
20179233 2010 Neuroblastoma progression correlates with downregulation of the lymphangiogenesis inhibitor sVEGFR-2.
20170163 2010 Identification of 2-anilino-9-methoxy-5,7-dihydro-6H-pyrimido[5,4-d][1]benzazepin-6-ones as dual PLK1/VEGF-R2 kinase inhibitor chemotypes by structure-based lead generation.
20167365 2010 Differential expression of VE-cadherin and VEGFR2 in placental syncytiotrophoblast during preeclampsia - New perspectives to explain the pathophysiology.
20164029 2009 Expression of VEGF receptors VEFGR-1 and VEGFR-2, angiopoietin receptors Tie-1 and Tie-2 in chorionic villi tree during early pregnancy.
20158395 2010 Fetal death: a condition with a dissociation in the concentrations of soluble vascular endothelial growth factor receptor-2 between the maternal and fetal compartments.
20158393 2010 Evidence in support of a role for anti-angiogenic factors in preterm prelabor rupture of membranes.
20145116 2010 Structural determinants of growth factor binding and specificity by VEGF receptor 2.
20143086 2010 Microvessel density and the association with single nucleotide polymorphisms of the vascular endothelial growth factor receptor 2 in patients with colorectal cancer.
20135347 2010 Epidermal growth factor receptor and vascular endothelial growth factor receptor 2 are specific biomarkers in triple-negative breast cancer. Results from a controlled randomized trial with long-term follow-up.
20124452 2010 Dependence on phosphoinositide 3-kinase and RAS-RAF pathways drive the activity of RAF265, a novel RAF/VEGFR2 inhibitor, and RAD001 (Everolimus) in combination.
20103629 2010 Sunitinib acts primarily on tumor endothelium rather than tumor cells to inhibit the growth of renal cell carcinoma.
20103598 2010 Herbal compound farnesiferol C exerts antiangiogenic and antitumor activity and targets multiple aspects of VEGFR1 (Flt1) or VEGFR2 (Flk1) signaling cascades.
20084057 2010 TIMP-2 modulates VEGFR-2 phosphorylation and enhances phosphodiesterase activity in endothelial cells.
20084021 2010 Vascular endothelial growth factor and its high-affinity receptor (VEGFR-2) are highly expressed in the human forebrain and cerebellum during development.
20080685 2010 Direct contacts between extracellular membrane-proximal domains are required for VEGF receptor activation and cell signaling.
20048182 2010 Phase I pharmacologic and biologic study of ramucirumab (IMC-1121B), a fully human immunoglobulin G1 monoclonal antibody targeting the vascular endothelial growth factor receptor-2.
20032607 2009 VEGFR2 expression and relationship between tumor neovascularization and histologic characteristics in oral squamous cell carcinoma.
20026801 2010 Phase I/II trial of metronomic chemotherapy with daily dalteparin and cyclophosphamide, twice-weekly methotrexate, and daily prednisone as therapy for metastatic breast cancer using vascular endothelial growth factor and soluble vascular endothelial growth factor receptor levels as markers of response.
20019880 2009 Polymorphisms in the VEGFA and VEGFR-2 genes and neovascular age-related macular degeneration.
20008289 2010 Cutting edge: Vascular endothelial growth factor-mediated signaling in human CD45RO+ CD4+ T cells promotes Akt and ERK activation and costimulates IFN-gamma production.
19965681 2010 Induction of nitric oxide by erythropoietin is mediated by the {beta} common receptor and requires interaction with VEGF receptor 2.
19953880 2009 [Association of variants in the vascular endothelial growth factor receptor 2 gene and the risk of hemorrhagic stroke].
19936766 2010 K-ras mutation status correlates with the expression of VEGFR1, VEGFR2, and PDGFRalpha in colorectal cancer.
19924384 2011 Pharmacogenetics of telatinib, a VEGFR-2 and VEGFR-3 tyrosine kinase inhibitor, used in patients with solid tumors.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19902430 2010 VEGFR2 is selectively expressed by FOXP3high CD4+ Treg.
19888537 2009 Variable effects of alpha v suppression on VEGFR-2 expression in endothelial cells of different vascular beds.
19881969 2009 Soluble and membranous vascular endothelial growth factor receptor-2 in pregnancies complicated by pre-eclampsia.
19875757 2010 Clinical relevance of vascular endothelial growth factor (VEGFA) and VEGF receptor (VEGFR2) gene polymorphism on the treatment outcome following imatinib therapy.
19862822 2010 Frequent deletion of CDKN2A and recurrent coamplification of KIT, PDGFRA, and KDR in fibrosarcoma of bone--an array comparative genomic hybridization study.
19860625 2009 Lysophosphatidic acid receptor expression in chronic lymphocytic leukemia leads to cell survival mediated though vascular endothelial growth factor expression.
19857463 2009 Neuropilin-1 forms complexes with vascular endothelial growth factor receptor-2 during megakaryocytic differentiation of UT-7/TPO cells.
19850021 2010 Serum levels of vascular endothelial growth factor and its receptors in patients with severe autism.
19837976 2009 EMMPRIN promotes angiogenesis through hypoxia-inducible factor-2alpha-mediated regulation of soluble VEGF isoforms and their receptor VEGFR-2.
19837659 2009 Alphav beta3 integrin limits the contribution of neuropilin-1 to vascular endothelial growth factor-induced angiogenesis.
19834490 2010 VEGF-dependent tumor angiogenesis requires inverse and reciprocal regulation of VEGFR1 and VEGFR2.
19811263 2009 Selected angiogenic cytokines in systemic lupus erythematosus patients.
19782046 2009 Glucose is a key regulator of VEGFR2/KDR in human epithelial ovarian carcinoma cells.
19779861 2010 Amplification and overexpression of KIT, PDGFRA, and VEGFR2 in medulloblastomas and primitive neuroectodermal tumors.
19776290 2010 Overexpression and activation of EGFR and VEGFR2 in medullary thyroid carcinomas is related to metastasis.
19773544 2009 A CD44v6 peptide reveals a role of CD44 in VEGFR-2 signaling and angiogenesis.
19761875 2010 Structure-function analysis of VEGF receptor activation and the role of coreceptors in angiogenic signaling.
19741061 2010 VEGF gene haplotypes are associated with sarcoidosis.
19726758 2010 Transmembrane domain-mediated orientation of receptor monomers in active VEGFR-2 dimers.
19707156 2009 Expression of VEGF and VEGF receptors in childhood precursor B-cell acute lymphoblastic leukemia evaluated by immunohistochemistry.
19706681 2009 VEGFR2-PLCgamma1 axis is essential for endothelial specification of VEGFR2+ vascular progenitor cells.
19706677 2009 Dopamine regulates phosphorylation of VEGF receptor 2 by engaging Src-homology-2-domain-containing protein tyrosine phosphatase 2.
19701853 2009 Expression level, tissue distribution pattern, and prognostic impact of vascular endothelial growth factors VEGF and VEGF-C and their receptors Flt-1, KDR, and Flt-4 in different subtypes of non-Hodgkin lymphomas.
19695569 2010 Soluble VEGF receptor-2 is increased in sera of subjects with metabolic syndrome in association with insulin resistance.
19668192 2009 Alternatively spliced vascular endothelial growth factor receptor-2 is an essential endogenous inhibitor of lymphatic vessel growth.
19665480 2009 A promising new approach of VEGFR2-based DNA vaccine for tumor immunotherapy.
19636022 2009 Phase I dose escalation study of telatinib, a tyrosine kinase inhibitor of vascular endothelial growth factor receptor 2 and 3, platelet-derived growth factor receptor beta, and c-Kit, in patients with advanced or metastatic solid tumors.
19633424 2009 The expression of VEGF receptor genes is concurrently influenced by epigenetic gene silencing of the genes and VEGF activation.
19605404 2009 High levels of circulating VEGFR2+ Bone marrow-derived progenitor cells correlate with metastatic disease in patients with pediatric solid malignancies.
19595210 2009 [Evaluation of angiogenesis in the tumorigenesis and progression of breast cancer].
19570985 2009 Vascular endothelial growth factor (VEGF) receptor-2 tyrosine 1175 signaling controls VEGF-induced von Willebrand factor release from endothelial cells via phospholipase C-gamma 1- and protein kinase A-dependent pathways.
19563658 2009 Molecular characterization of EGFR, PDGFRA and VEGFR2 in cervical adenosquamous carcinoma.
19558547 2009 (-)-Epigallocatechin gallate suppresses the growth of human hepatocellular carcinoma cells by inhibiting activation of the vascular endothelial growth factor-vascular endothelial growth factor receptor axis.
19521715 2009 Association of the VEGFR2 gene His472Gln polymorphism with endurance-related phenotypes.
19520980 2009 VEGF receptor-2 variants are associated with susceptibility to stroke and recurrence.
19469899 2009 Inhibition of Rac1 GTPase downregulates vascular endothelial growth factor receptor-2 expression by suppressing Sp1-dependent DNA binding in human endothelial cells.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19435508 2009 The -271 G>A polymorphism of kinase insert domain-containing receptor gene regulates its transcription level in patients with non-small cell lung cancer.
19419943 2009 Soluble angiogenesis markers in gastric tumor patients.
19409555 2010 Vascular endothelial growth factor A and its two receptors in human preantral follicles from fetuses, girls, and women.
19375500 2009 A role for NADPH oxidase 4 in the activation of vascular endothelial cells by oxidized phospholipids.
19372622 2009 Role of stromal cell-derived factor-1alpha, level and value of circulating interleukin-10 and endothelial progenitor cells in patients with acute myocardial infarction undergoing primary coronary angioplasty.
19372461 2009 Rab GTPase regulation of VEGFR2 trafficking and signaling in endothelial cells.
19372376 2009 Upstream open reading frames cause widespread reduction of protein expression and are polymorphic among humans.
19324448 2009 Vascular endothelial growth factor A and vascular endothelial growth factor receptor 2 expression in non-small cell lung cancer patients: relation to prognosis.
19287991 2009 Comparative study of human colonic tumor-derived endothelial cells (HCTEC) and normal colonic microvascular endothelial cells (HCMEC): Hypoxia-induced sVEGFR-1 and sVEGFR-2 levels.
19267251 2009 Cooperation between integrin alphavbeta3 and VEGFR2 in angiogenesis.
19265684 2009 CCL23 up-regulates expression of KDR/Flk-1 and potentiates VEGF-induced proliferation and migration of human endothelial cells.
19261502 2009 Relationship between circulating vascular endothelial growth factor and its soluble receptors in adults with dengue virus infection: a case-control study.
19246491 2009 Signaling mechanism of extracellular RNA in endothelial cells.
19244479 2009 Chronic hypoxia attenuates VEGF signaling and angiogenic responses by downregulation of KDR in human endothelial cells.
19230644 2009 VEGFs and receptors involved in angiogenesis versus lymphangiogenesis.
19218116 2009 [Expression of vascular endothelial growth factor and its receptor Flk-1/KDR in benign and malignant breast neoplasms].
19200976 2009 Expression of vascular endothelial growth factor receptors in the endometrium of septate uterus.
19199116 2009 Secretion of soluble VEGF receptor 2 by microvascular endothelial cells derived by human benign prostatic hyperplasia.
19179362 2009 Requirement of Fut8 for the expression of vascular endothelial growth factor receptor-2: a new mechanism for the emphysema-like changes observed in Fut8-deficient mice.
19177438 2009 Vascular endothelial growth factor receptor 2 expression in non-tumorous cirrhotic liver is higher when hepatoma is beyond Milan criteria.
19176370 2009 The plexin-A1 receptor activates vascular endothelial growth factor-receptor 2 and nuclear factor-kappaB to mediate survival and anchorage-independent growth of malignant mesothelioma cells.
19160077 2009 Lack of somatic mutations in VEGFR-2 tyrosine kinase domain in hepatocellular carcinoma.
19141860 2009 Genetic variants in the candidate genes of the apoptosis pathway and susceptibility to chronic myeloid leukemia.
19136612 2009 Transcriptional profiling reveals a critical role for tyrosine phosphatase VE-PTP in regulation of VEGFR2 activity and endothelial cell morphogenesis.
19110567 2008 Vascular endothelial growth factor and its type 2 receptor in tumors and serum of patients with renal cancer.
19082506 2009 Hypoxia-induced reduction of sVEGFR-2 levels in human colonic microvascular endothelial cells in vitro: Comparative study with HUVEC.
19068081 2009 Impact of vascular endothelial growth factor receptor 1, 2, and 3 expression on the outcome of patients with gastric cancer.
19066962 2009 Protein expression profiling of vascular endothelial growth factor and its receptors identifies subclasses of hepatocellular carcinoma and predicts survival.
19058181 2009 Functional significance of VEGFR-2 on ovarian cancer cells.
19033661 2008 AIP1 functions as an endogenous inhibitor of VEGFR2-mediated signaling and inflammatory angiogenesis in mice.
19023980 2008 Expression of VEGF and VEGFR2 in tumors during neoadjuvant therapy of patients with breast cancer.
19021062 2008 Lactate dehydrogenase 5 expression in non-Hodgkin B-cell lymphomas is associated with hypoxia regulated proteins.
19020728 2008 Glioma cells enhance endothelial progenitor cell angiogenesis via VEGFR-2, not VEGFR-1.
19014781 2008 Correlation between tumor growth delay and expression of cancer and host VEGF, VEGFR2, and osteopontin in response to radiotherapy.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18987662 2009 The role of VEGF and a functional link between VEGF and p27Kip1 in acute myeloid leukemia.
18975312 2008 Angiogenesis in systemic sclerosis: impaired expression of vascular endothelial growth factor receptor 1 in endothelial progenitor-derived cells under hypoxic conditions.
18936167 2009 New role for the protein tyrosine phosphatase DEP-1 in Akt activation and endothelial cell survival.
18931684 2008 Suppressed NFAT-dependent VEGFR1 expression and constitutive VEGFR2 signaling in infantile hemangioma.
18922344 2008 The expression of vascular endothelial growth factor and its receptors in port-wine stains.
18840653 2008 The protein tyrosine phosphatase TCPTP controls VEGFR2 signalling.
18824714 2008 Association of vascular endothelial growth factor and vascular endothelial growth factor receptor-2 genetic polymorphisms with outcome in a trial of paclitaxel compared with paclitaxel plus bevacizumab in advanced breast cancer: ECOG 2100.
18818406 2008 VEGF-A stimulates ADAM17-dependent shedding of VEGFR2 and crosstalk between VEGFR2 and ERK signaling.
18785001 2009 Exploratory study evaluating the association of polymorphisms of angiogenesis genes with hot flashes.
18784964 Quantitative PET imaging of VEGF receptor expression.
18719373 2008 Autocrine regulation of glioblastoma cell cycle progression, viability and radioresistance through the VEGF-VEGFR2 (KDR) interplay.
18692535 2008 Adrenomedullin stimulates angiogenic response in cultured human vascular endothelial cells: involvement of the vascular endothelial growth factor receptor 2.
18680722 2008 VEGF receptor protein-tyrosine kinases: structure and regulation.
18662404 2008 The neurotransmitter dopamine modulates vascular permeability in the endothelium.
18656381 2008 Circulating vascular endothelial growth factor and its soluble receptors in patients with liver cirrhosis: possible association with hepatic function impairment.
18651620 2008 Parathyroid hormone-related protein (107-139) increases human osteoblastic cell survival by activation of vascular endothelial growth factor receptor-2.
18645275 2008 Expression of vascular endothelial growth factor, receptor KDR and p53 protein in transitional cell carcinoma of the bladder.
18628209 2008 Neuropilin-1-VEGFR-2 complexing requires the PDZ-binding domain of neuropilin-1.
18609713 2008 Measurement of circulating levels of VEGF-A, -C, and -D and their receptors, VEGFR-1 and -2 in gastric adenocarcinoma.
18594014 2008 Human CD4+ T lymphocytes recognize a vascular endothelial growth factor receptor-2-derived epitope in association with HLA-DR.
18593464 2008 Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.
18564921 2008 Candidate gene analysis in primary lymphedema.
18529047 2008 Design, synthesis, and biological evaluation of novel 3-aryl-4-(1H-indole-3yl)-1,5-dihydro-2H-pyrrole-2-ones as vascular endothelial growth factor receptor (VEGF-R) inhibitors.
18509004 2008 Interactions between sphingosine-1-phosphate and vascular endothelial growth factor signalling in ML-1 follicular thyroid carcinoma cells.
18421240 2008 PlGF-1 and VEGFR-1 pathway regulation of the external epithelial hemato-ocular barrier. A model for retinal edema.
18396391 2008 Immunocytochemical localization of vascular endothelial growth factor and vascular endothelial growth factor receptor-2 of the human deciduous molar tooth germ development in the human fetus.
18379357 2008 A randomized, double-blind, phase IIa dose-finding study of Vandetanib (ZD6474) in Japanese patients with non-small cell lung cancer.
18377662 2008 Src homology 2 (SH2) domain containing protein tyrosine phosphatase-1 (SHP-1) dephosphorylates VEGF Receptor-2 and attenuates endothelial DNA synthesis, but not migration*.
18356031 2008 Immunohistochemical expression of vascular endothelial growth factor A (VEGF), and its receptors (VEGFR1, 2) in normal and pathologic conditions of the human thymus.
18337563 2008 TNF primes endothelial cells for angiogenic sprouting by inducing a tip cell phenotype.
18317954 2008 Prognostic and predictive value of vascular endothelial growth factor and its soluble receptors, VEGFR-1 and VEGFR-2 levels in the sera of small cell lung cancer patients.
18261985 2008 Specific association of increased vascular endothelial growth factor expression and its receptors with macrophage differentiation of HL-60 leukemia cells.
18223683 2008 Galectin-1, a novel ligand of neuropilin-1, activates VEGFR-2 signaling and modulates the migration of vascular endothelial cells.
18218912 2008 A maximal exercise bout increases the number of circulating CD34+/KDR+ endothelial progenitor cells in healthy subjects. Relation with lipid profile.
18211808 2008 Class II histone deacetylases play pivotal roles in heat shock protein 90-mediated proteasomal degradation of vascular endothelial growth factor receptors.
18194650 2008 Angiopoietin-1 prevents VEGF-induced endothelial permeability by sequestering Src through mDia.
18175243 2008 Low maternal concentrations of soluble vascular endothelial growth factor receptor-2 in preeclampsia and small for gestational age.
18164591 2008 Vascular endothelial growth factor regulates stanniocalcin-1 expression via neuropilin-1-dependent regulation of KDR and synergism with fibroblast growth factor-2.
18162457 In vitro cultured progenitors and precursors of cardiac cell lineages from human normal and post-ischemic hearts.
18037047 2007 Vascular endothelial growth factor receptor-2 expression in the pulp of human primary and young permanent teeth.
18035072 2007 Polymorphisms in hypoxia inducible factor 1 and the initial clinical presentation of coronary disease.
18006432 2008 Activation of fractalkine/CX3CR1 by vascular endothelial cells induces angiogenesis through VEGF-A/KDR and reverses hindlimb ischaemia.
17999592 2007 Flk-1+ adipose-derived mesenchymal stem cells differentiate into skeletal muscle satellite cells and ameliorate muscular dystrophy in mdx mice.
17979890 Increased VEGFR2 expression during human late endothelial progenitor cells expansion enhances in vitro angiogenesis with up-regulation of integrin alpha(6).
17961532 2008 Expression profile of total VEGF, VEGF splice variants and VEGF receptors in the myocardium and arterial vasculature of diabetic and non-diabetic patients with coronary artery disease.
17928406 2007 Transactivation of vascular endothelial growth factor receptor-2 by interleukin-8 (IL-8/CXCL8) is required for IL-8/CXCL8-induced endothelial permeability.
17927494 2007 Elevated tumor necrosis factor-alpha suppresses TAZ expression and impairs osteogenic potential of Flk-1+ mesenchymal stem cells in patients with multiple myeloma.
17891484 2008 Association of polymorphisms of angiogenesis genes with breast cancer.
17881084 2008 Heparin affin regulatory peptide/pleiotrophin negatively affects diverse biological activities in C6 glioma cells.
17850794 2007 VEGF receptor Flk-1 plays an important role in c-kit expression in adipose tissue derived stem cells.
17765237 2008 Vascular density and distribution of vascular endothelial growth factor (VEGF) and its receptor VEGFR-2 (Flk-1) are significantly higher in patients with deeply infiltrating endometriosis affecting the rectum.
17722983 2007 Early endocardial morphogenesis requires Scl/Tal1.
17721629 2007 VEGFR2 expressing circulating (progenitor) cell populations in volunteers and cancer patients.
17707181 2007 Polymorphisms of KDR gene are associated with coronary heart disease.
17702744 2007 Myoferlin regulates vascular endothelial growth factor receptor-2 stability and function.
17658244 2007 Vascular endothelial growth factor receptor-2: structure, function, intracellular signalling and therapeutic inhibition.
17651148 2007 Increased expression of tissue vascular endothelial growth factor and foetal liver kinase-1 receptor in seasonal allergic rhinitis and relevance to asthma component.
17646929 2007 The VEGFR2 and PKA pathways converge at MEK/ERK1/2 to promote survival in serum deprived neuronal cells.
17641225 2007 Mechanisms of integrin-vascular endothelial growth factor receptor cross-activation in angiogenesis.
17640715 2007 Vascular endothelial growth factor, its receptor Flk-1, and hypoxia inducible factor-1alpha are involved in malignant transformation in dysplastic nodules of the liver.
17631646 2007 Induction of cell cycle arrest and apoptosis in human nasopharyngeal carcinoma cells by ZD6474, an inhibitor of VEGFR tyrosine kinase with additional activity against EGFR tyrosine kinase.
17599955 2007 Quantitative real-time reverse transcription PCR study of the expression of vascular endothelial growth factor (VEGF) splice variants and VEGF receptors (VEGFR-1 and VEGFR-2) in non small cell lung cancer.
17584927 2007 Elevated expression of VEGFR-3 in lymphatic endothelial cells from lymphangiomas.
17577783 2007 Coordinated deregulation of cellular receptors, proangiogenic factors and intracellular pathways in acute myeloid leukaemia.
17575273 2007 Neuropilin-1 binds to VEGF121 and regulates endothelial cell migration and sprouting.
17490619 2007 Crosstalk between VEGF-A/VEGFR2 and GDNF/RET signaling pathways.
17470361 2007 Mechanism of vascular endothelial growth factor expression mediated by cisplatin in human ovarian cancer cells.
17462601 2007 An antibody directed against PDGF receptor beta enhances the antitumor and the anti-angiogenic activities of an anti-VEGF receptor 2 antibody.
17456229 2007 Screening of the transcriptional regulatory regions of vascular endothelial growth factor receptor 2 (VEGFR2) in amyotrophic lateral sclerosis.
17372230 2007 A critical role for the E3-ligase activity of c-Cbl in VEGFR-2-mediated PLCgamma1 activation and angiogenesis.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17336974 2007 Wall discontinuities and increased expression of vascular endothelial growth factor-A and vascular endothelial growth factor receptors 1 and 2 in endometrial blood vessels of women with menorrhagia.
17303569 2007 Phosphorylation of tyrosine 801 of vascular endothelial growth factor receptor-2 is necessary for Akt-dependent endothelial nitric-oxide synthase activation and nitric oxide release from endothelial cells.
17293873 2007 Structure of a VEGF-VEGF receptor complex determined by electron microscopy.
17253678 2007 Evolution of a highly selective and potent 2-(pyridin-2-yl)-1,3,5-triazine Tie-2 kinase inhibitor.
17242158 2007 Proprotein convertases promote processing of VEGF-D, a critical step for binding the angiogenic receptor VEGFR-2.
17222790 2007 Blocking neuropilin-1 function has an additive effect with anti-VEGF to inhibit tumor growth.
17088944 Immunolocalization and expression of vascular endothelial growth factor receptors (VEGFRs) and neuropilins (NRPs) on keratinocytes in human epidermis.
17018613 2006 Tumor-induced activation of lymphatic endothelial cells via vascular endothelial growth factor receptor-2 is critical for prostate cancer lymphatic metastasis.
17013089 2006 Circulating serum levels of angiogenic factors and vascular endothelial growth factor receptors 1 and 2 in melanoma patients.
17004325 2006 Intrinsic tyrosine kinase activity is required for vascular endothelial growth factor receptor 2 ubiquitination, sorting and degradation in endothelial cells.
17002866 2006 Differential roles of vascular endothelial growth factor receptor-1 and receptor-2 in angiogenesis.
16966330 2006 Phosphorylation of Tyr1214 within VEGFR-2 triggers the recruitment of Nck and activation of Fyn leading to SAPK2/p38 activation and endothelial cell migration in response to VEGF.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16951193 2006 Vascular endothelial growth factor overexpression by soft tissue sarcoma cells: implications for tumor growth, metastasis, and chemoresistance.
16930552 2006 Expression of VEGFR-2 on HaCaT cells is regulated by VEGF and plays an active role in mediating VEGF induced effects.
16914267 2006 The vascular endothelial growth factor VEGF165 induces perlecan synthesis via VEGF receptor-2 in cultured human brain microvascular endothelial cells.
16914140 2006 Complex formation between tissue transglutaminase II (tTG) and vascular endothelial growth factor receptor 2 (VEGFR-2): proposed mechanism for modulation of endothelial cell response to VEGF.
16909199 2006 A VEGF-A splice variant defective for heparan sulfate and neuropilin-1 binding shows attenuated signaling through VEGFR-2.
16893970 2006 Vascular endothelial cadherin controls VEGFR-2 internalization and signaling from intracellular compartments.
16870555 2006 Differential expression of vascular endothelial growth factors and their receptors in multiple myeloma.
16835828 2006 Immunolocalizations of VEGF, its receptors flt-1, KDR and TGF-beta's in epithelial ovarian tumors.
16835467 2006 Signal transduction via vascular endothelial growth factor (VEGF) receptors and their roles in atherogenesis.
16807673 2007 Polymorphisms in the KDR and POSTN genes: association with breast cancer susceptibility and prognosis.
16787925 2006 The adaptor protein Gab1 couples the stimulation of vascular endothelial growth factor receptor-2 to the activation of phosphoinositide 3-kinase.
16786116 2006 Expression of vascular endothelial growth factor receptors is closely related to the histological grade of hepatocellular carcinoma.
16782059 2006 HESR1/CHF2 suppresses VEGFR2 transcription independent of binding to E-boxes.
16763549 2006 Glycosaminoglycan modification of neuropilin-1 modulates VEGFR2 signaling.
16761623 2006 The effects of VEGF and VEGFR-2 on survival in patients with gastric cancer.