Property Summary

Ligand Count 1,726
NCBI Gene PubMed Count 817
PubMed Score 4544.83
PubTator Score 2715.46

Knowledge Summary

Patent (506,465)

TINX Plot

  Disease (7)

Disease Target Count
Angiosarcoma 11

Expression

  Differential Expression (16)

Disease log2 FC p
lung cancer -2.300 2.3e-05
chronic rhinosinusitis 1.160 2.1e-02
cystic fibrosis -1.300 1.7e-02
facioscapulohumeral dystrophy -2.500 1.4e-04
glioblastoma 1.200 1.4e-02
interstitial cystitis 1.200 2.7e-04
intraductal papillary-mucinous carcinoma... -1.200 1.1e-02
intraductal papillary-mucinous neoplasm ... -1.100 3.9e-02
invasive ductal carcinoma -1.100 1.5e-02
lung adenocarcinoma -1.300 2.7e-08
malignant mesothelioma -7.100 3.5e-10
non-small cell lung cancer -1.048 3.3e-05
ovarian cancer -5.400 1.6e-17
posterior fossa group A ependymoma 1.100 2.5e-05
ulcerative colitis 1.200 1.2e-03
urothelial carcinoma 1.700 2.5e-03

Synonym

Accession P35968 A2RRS0 B5A925 C5IFA0 O60723 Q14178 VEGFR-2
Symbols FLK1
CD309
VEGFR
VEGFR2

Gene

KDR

PDB (48)

Gene RIF (772)

AA Sequence

MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGS      1 - 70
EQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITE     71 - 140
NKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQ    141 - 210
SIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQ    211 - 280
SGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRI    281 - 350
PAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP    351 - 420
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVED    421 - 490
FQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQ    491 - 560
PTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSNSTNDILIMELK    561 - 630
NASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMW    631 - 700
FKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVG    701 - 770
TAVIAMFFWLLLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL    771 - 840
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGG    841 - 910
PLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASSGFVEE    911 - 980
KSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLA    981 - 1050
RDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLK   1051 - 1120
EGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDS   1121 - 1190
GLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS   1191 - 1260
GMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLI   1261 - 1330
EIGVQTGSTAQILQPDSGTTLSSPPV                                               1331 - 1356
//

Text Mined References (842)

PMID Year Title