Property Summary

Ligand Count 11
NCBI Gene PubMed Count 18
PubMed Score 28.33
PubTator Score 11.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 1.2e-08
medulloblastoma, large-cell 6241 6.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 3.700 1.2e-08
medulloblastoma, large-cell 1.100 6.1e-04

PDB (263)

Gene RIF (8)

AA Sequence

METMKSKANCAQNPNCNIMIFHPTKEEFNDFDKYIAYMESQGAHRAGLAKIIPPKEWKARETYDNISEIL      1 - 70
IATPLQQVASGRAGVFTQYHKKKKAMTVGEYRHLANSKKYQTPPHQNFEDLERKYWKNRIYNSPIYGADI     71 - 140
SGSLFDENTKQWNLGHLGTIQDLLEKECGVVIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHLGEPK    141 - 210
TWYVVPPEHGQRLERLARELFPGSSRGCGAFLRHKVALISPTVLKENGIPFNRITQEAGEFMVTFPYGYH    211 - 280
AGFNHGFNCAEAINFATPRWIDYGKMASQCSCGEARVTFSMDAFVRILQPERYDLWKRGQDRAVVDHMEP    281 - 350
RVPASQELSTQKEVQLPRRAALGLRQLPSHWARHSPWPMAARSGTRCHTLVCSSLPRRSAVSGTATQPRA    351 - 420
AAVHSSKKPSSTPSSTPGPSAQIIHPSNGRRGRGRPPQKLRAQELTLQTPAKRPLLAGTTCTASGPEPEP    421 - 490
LPEDGALMDKPVPLSPGLQHPVKASGCSWAPVP                                         491 - 523
//

Text Mined References (21)

PMID Year Title