Property Summary

NCBI Gene PubMed Count 15
PubMed Score 22.41
PubTator Score 11.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3163 1.2e-08
medulloblastoma, large-cell 6234 6.1e-04

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 3.700 1.2e-08
medulloblastoma, large-cell 1.100 6.1e-04

Gene RIF (6)

PMID Text
25714495 KDM4D-RNA interaction is required for KDM4D accumulation at DNA breakage sites
24550317 PARP1-dependent recruitment of KDM4D histone demethylase to DNA damage sites promotes double-strand break repair.
23219879 The molecular basis for JMJD2 site specificity revealed by X-ray crystallography.
22514644 Results demonstrate that JMJD2D can stimulate cell proliferation and survival, suggesting that its inhibition may be helpful in the fight against cancer
18187620 Knockdown of lysine (K)-specific demethylase 4D (KDM4D) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17555712 identified two related histone demethylases, JMJD2A and JMJD2D

AA Sequence

METMKSKANCAQNPNCNIMIFHPTKEEFNDFDKYIAYMESQGAHRAGLAKIIPPKEWKARETYDNISEIL      1 - 70
IATPLQQVASGRAGVFTQYHKKKKAMTVGEYRHLANSKKYQTPPHQNFEDLERKYWKNRIYNSPIYGADI     71 - 140
SGSLFDENTKQWNLGHLGTIQDLLEKECGVVIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHLGEPK    141 - 210
TWYVVPPEHGQRLERLARELFPGSSRGCGAFLRHKVALISPTVLKENGIPFNRITQEAGEFMVTFPYGYH    211 - 280
AGFNHGFNCAEAINFATPRWIDYGKMASQCSCGEARVTFSMDAFVRILQPERYDLWKRGQDRAVVDHMEP    281 - 350
RVPASQELSTQKEVQLPRRAALGLRQLPSHWARHSPWPMAARSGTRCHTLVCSSLPRRSAVSGTATQPRA    351 - 420
AAVHSSKKPSSTPSSTPGPSAQIIHPSNGRRGRGRPPQKLRAQELTLQTPAKRPLLAGTTCTASGPEPEP    421 - 490
LPEDGALMDKPVPLSPGLQHPVKASGCSWAPVP                                         491 - 523
//

Text Mined References (17)

PMID Year Title
25714495 2015 The emerging role of lysine demethylases in DNA damage response: dissecting the recruitment mode of KDM4D/JMJD2D to DNA damage sites.
25124442 2014 Transdifferentiation. Sequential histone-modifying activities determine the robustness of transdifferentiation.
24550317 2014 PARP1-dependent recruitment of KDM4D histone demethylase to DNA damage sites promotes double-strand break repair.
23219879 2013 Structural and functional analysis of JMJD2D reveals molecular basis for site-specific demethylation among JMJD2 demethylases.
23102699 2012 Poly (ADP-ribose) glycohydrolase regulates retinoic acid receptor-mediated gene expression.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22514644 2012 Regulation of tumor suppressor p53 and HCT116 cell physiology by histone demethylase JMJD2D/KDM4D.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17555712 2007 Activation of androgen receptor by histone demethylases JMJD2A and JMJD2D.
16603238 2006 Reversal of histone lysine trimethylation by the JMJD2 family of histone demethylases.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15138608 2004 Identification and characterization of JMJD2 family genes in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.