Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.49
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.600 4.3e-04
Astrocytoma, Pilocytic 1.700 4.5e-08
atypical teratoid / rhabdoid tumor 1.700 9.7e-09
ependymoma 1.800 4.0e-16
glioblastoma 1.700 1.0e-09
group 3 medulloblastoma 1.200 1.5e-02
lung carcinoma -1.500 8.0e-14
medulloblastoma, large-cell 1.100 1.0e-02
ovarian cancer -1.100 4.6e-03
pancreatic cancer 1.100 7.3e-03
primitive neuroectodermal tumor 1.100 3.8e-02

AA Sequence

MRRLPRALLLQLRLALLVAAGAPEVLVSAPRSLVWGPGLQAAVVLPVRYFYLQAVNSEGQNLTRSPAGET      1 - 70
PFKVVVKSLSPKELVRIHVPKPLDRNDGTFLMRYRMYETVDEGLKIEVLYGDEHVAQSPYILKGPVYHEY     71 - 140
CECPEDPQAWQKTLSCPTKEPQIAKDFASFPSINLQQMLKEVPKRFGDERGAIVHYTILNNHVYRRSLGK    141 - 210
YTDFKMFSDEILLSLTRKVLLPDLEFYVNLGDWPLEHRKVNGTPSPIPIISWCGSLDSRDVVLPTYDITH    211 - 280
SMLEAMRGVTNDLLSIQGNTGPSWINKTERAFFRGRDSREERLQLVQLSKENPQLLDAGITGYFFFQEKE    281 - 350
KELGKAKLMGFFDFFKYKYQVNVDGTVAAYRYPYLMLGDSLVLKQDSPYYEHFYMALEPWKHYVPIKRNL    351 - 420
SDLLEKVKWAKENDEEAKKIAKEGQLMARDLLQPHRLYCYYYQVLQKYAERQSSKPEVRDGMELVPQPED    421 - 490
STAICQCHRKKPSREEL                                                         491 - 507
//

Text Mined References (7)

PMID Year Title