Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.64
PubTator Score 3.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.500 1.3e-02
posterior fossa group B ependymoma 1.300 6.0e-05
spina bifida -1.293 4.4e-02
Breast cancer -1.700 4.0e-15
ovarian cancer -1.900 8.3e-05

Synonym

Accession Q7L273 Q6NUM8 Q9NXV4
Symbols BTBD27

Gene

PDB

5BXH  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
26334369 The authors find that the KCTD proteins 5, 6, 9 and 17 bind to Cul3 with high affinity, while the KCTD proteins 1 and 16 do not have detectable binding.
23376586 These results suggest the involvement of KCTD9 in NK cell activation and provide additional insight into a potential therapeutic target for molecular manipulation for hepatitis B virus-induced acute-on-chronic liver failure patients
19032868 The increased expression of potassium channel gene KCTD9 correlates with disease severity in patients with viral hepatitis B.

AA Sequence

MRRVTLFLNGSPKNGKVVAVYGTLSDLLSVASSKLGIKATSVYNGKGGLIDDIALIRDDDVLFVCEGEPF      1 - 70
IDPQTDSKPPEGLLGFHTDWLTLNVGGRYFTTTRSTLVNKEPDSMLAHMFKDKGVWGNKQDHRGAFLIDR     71 - 140
SPEYFEPILNYLRHGQLIVNDGINLLGVLEEARFFGIDSLIEHLEVAIKNSQPPEDHSPISRKEFVRFLL    141 - 210
ATPTKSELRCQGLNFSGADLSRLDLRYINFKMANLSRCNLAHANLCCANLERADLSGSVLDCANLQGVKM    211 - 280
LCSNAEGASLKLCNFEDPSGLKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDL    281 - 350
ENCDLSGCDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR                                   351 - 389
//

Text Mined References (12)

PMID Year Title
26334369 2016 Structural Insights into KCTD Protein Assembly and Cullin3 Recognition.
25416956 2014 A proteome-scale map of the human interactome network.
23376586 2013 KCTD9 contributes to liver injury through NK cell activation during hepatitis B virus-induced acute-on-chronic liver failure.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19032868 2008 [Increased expression of KCTD9, a novel potassium channel related gene, correlates with disease severity in patients with viral hepatitis B].
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11483580 2001 Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs.