Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.06
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
aldosterone-producing adenoma -1.435 2.2e-02
astrocytoma 1.100 1.7e-15
Astrocytoma, Pilocytic 1.200 5.0e-05
diabetes mellitus -1.100 1.3e-03
intraductal papillary-mucinous adenoma (... 1.100 4.6e-02
lung adenocarcinoma -1.200 1.9e-06
lung cancer 1.300 9.9e-05
medulloblastoma, large-cell 1.200 7.7e-04
nasopharyngeal carcinoma 1.300 2.7e-04
oligodendroglioma 1.100 2.6e-10
ovarian cancer -1.500 5.3e-04
pediatric high grade glioma 1.100 3.3e-04
psoriasis -1.200 2.6e-04
spina bifida -1.836 4.1e-02
tuberculosis 1.200 2.3e-04

Gene RIF (1)

AA Sequence

MAGGHCGSFPAAAAGSGEIVQLNVGGTRFSTSRQTLMWIPDSFFSSLLSGRISTLRDETGAIFIDRDPAA      1 - 70
FAPILNFLRTKELDLRGVSINVLRHEAEFYGITPLVRRLLLCEELERSSCGSVLFHGYLPPPGIPSRKIN     71 - 140
NTVRSADSRNGLNSTEGEARGNGTQPVLSGTGEETVRLGFPVDPRKVLIVAGHHNWIVAAYAHFAVCYRI    141 - 210
KESSGWQQVFTSPYLDWTIERVALNAKVVGGPHGDKDKMVAVASESSIILWSVQDGGSGSEIGVFSLGVP    211 - 280
VDALFFIGNQLVATSHTGKVGVWNAVTQHWQVQDVVPITSYDTAGSFLLLGCNNGSIYYIDMQKFPLRMK    281 - 350
DNDLLVTELYHDPSNDAITALSVYLTPKTSVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVH    351 - 420
RSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLEETESHGSYSSGNDIGP    421 - 490
FGERDDQQVFIQKVVPITNKLFVRLSSTGKRICEIQAVDCTTISSFTVRECEGSSRMGSRPRRYLFTGHT    491 - 560
NGSIQMWDLTTAMDMVNKSEDKDVGGPTEEELLKLLDQCDLSTSRCATPNISPATSVVQHSHLRESNSSL    561 - 630
QLQHHDTTHEAATYGSMRPYRESPLLARARRTESFHSYRDFQTINLNRNVERAVPENGNLGPIQAEVKGA    631 - 700
TGECNISERKSPGVEIKSLRELDSGLEVHKIAEGFSESKKRSSEDENENKIEFRKKGGFEGGGFLGRKKV    701 - 770
PYLASSPSTSDGGTDSPGTASPSPTKTTPSPRHKKSDSSGQEYSL                             771 - 815
//

Text Mined References (14)

PMID Year Title