Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.27
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 3.9e-07
sonic hedgehog group medulloblastoma 467 1.2e-05
tuberculosis 2010 4.3e-05
hepatocellular carcinoma 547 8.0e-04
osteosarcoma 7950 1.2e-03
spina bifida 1074 2.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.200 3.9e-07
hepatocellular carcinoma 1.200 8.0e-04
osteosarcoma -1.252 1.2e-03
sonic hedgehog group medulloblastoma -1.300 1.2e-05
spina bifida -1.347 2.9e-02
tuberculosis -1.800 4.3e-05

Gene RIF (1)

AA Sequence

MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDL      1 - 70
PEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLNQRVQTVHFTVREAPQIYSLSSSS     71 - 140
MEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVEGLPEEEYTKQNLKRLWV    141 - 210
VPANKQINSFQVFVEEVLKIALSDGFCIDSSHPHALDFMNNKIIRLIRYR                        211 - 260
//

Text Mined References (5)

PMID Year Title