Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.03
PubTator Score 1.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute quadriplegic myopathy 1.001 9.1e-04
astrocytic glioma 1.500 9.2e-03
Astrocytoma, Pilocytic 1.100 9.7e-07
atypical teratoid / rhabdoid tumor 1.600 3.1e-05
cystic fibrosis -1.317 5.6e-04
diabetes mellitus -1.700 2.4e-03
ependymoma 1.100 3.6e-02
gastric carcinoma 1.500 4.1e-03
glioblastoma 1.500 7.0e-04
group 3 medulloblastoma 1.100 3.7e-03
intraductal papillary-mucinous neoplasm ... -1.200 9.2e-03
juvenile dermatomyositis 1.496 1.7e-12
medulloblastoma, large-cell 1.800 1.7e-04
oligodendroglioma 1.300 1.1e-02
osteosarcoma 3.228 6.0e-07
ovarian cancer -1.100 2.4e-03
pancreatic ductal adenocarcinoma liver m... -1.457 4.0e-02
pediatric high grade glioma 1.200 1.4e-06
Pick disease 1.200 4.3e-04
pituitary cancer -1.200 2.3e-06
spina bifida -1.852 4.3e-02
ulcerative colitis 1.300 2.5e-07

Synonym

Accession Q7Z5Y7 B4DZD3 B4E2Q3 F5H3T3 Q5W105 Q69YQ7 Q8IZ55
Symbols C6orf69
dJ108K11.3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MNVHRGSDSDRLLRQEASCLVDDTLAVAQEKEANSLASSGPHNLTYPLGPRNEDLSLDYASQPANLQFPH      1 - 70
IMPLAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPD     71 - 140
TMLGRMFGPGREYNFTRPNEKGEYEIAEGISATVFRTVLDYYKTGIINCPDGISIPDLRDTCDYLCINFD    141 - 210
FNTIRCQDLSALLHELSNDGAHKQFDHYLEELILPIMVGCAKKGERECHIVVLTDEDSVDWDEDHPPPMG    211 - 280
EEYSQILYSSKLYRFFKYIENRDVAKTVLKERGLKNIRIGIEGYPTCKEKIKRRPGGRSEVIYNYVQRPF    281 - 350
IQMSWEKEEGKSRHVDFQCVRSKSLTNLVAAGDDVLEDQEILMHHPPQVDELDRLNAPLSQMASNDFQD     351 - 419
//

Text Mined References (11)

PMID Year Title