Property Summary

NCBI Gene PubMed Count 27
PubMed Score 42.02
PubTator Score 30.83

Knowledge Summary

Patent (15,169)

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -2.100 1.7e-16
posterior fossa group B ependymoma -3.300 3.5e-07
oligodendroglioma -2.100 2.2e-02
glioblastoma -3.500 3.6e-04
osteosarcoma -3.282 7.7e-05
medulloblastoma -3.000 5.0e-03
cystic fibrosis 1.459 1.8e-05
atypical teratoid / rhabdoid tumor -3.900 2.4e-05
medulloblastoma, large-cell -2.400 4.6e-02
primitive neuroectodermal tumor -4.600 4.2e-04
Amyotrophic Lateral Sclerosis 1.849 1.7e-06
acute quadriplegic myopathy 1.502 9.2e-04
tuberculosis and treatment for 6 months 1.400 9.8e-06
pediatric high grade glioma -2.100 1.7e-02
pituitary cancer 3.100 3.2e-03

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
493046 confirmatory 0 / 0 / 5 Mode of action assay-Specificity test for the KCNQ2 activators in the KCNQ5 expressing cells

Gene RIF (14)

PMID Text
25672891 suggestive loci for periodontitis: KCNQ5 on chromosome 6q13 in a Japanese population. study should contribute to further understanding of genetic factors for enhanced susceptibility to periodontitis.
25127363 rs9351963 in KCNQ5 is a possible predictive factor of incidence of diarrhea in cancer patients treated with irinotecan chemotherapy.
24855057 Kv7.1/Kv7.5 form heterotetrameric channels increasing the diversity of structures which fine-tune blood vessel reactivity. The lipid raft localization of Kv7.1/Kv7.5 heteromers provides efficient spatial and temporal regulation of smooth muscle function.
24297175 Differential protein kinase C-dependent modulation of Kv7.4 and Kv7.5 subunits of vascular Kv7 channels.
22347474 characterized the cell-type specific spatial organization of the kcnq5 gene locus mediated by CTCF in detail using chromosome conformation capture (3C) and 3C-derived techniques
22190306 The results of this study indicated that Kv7.5 contributes to the spatial regulation of KCNE3.
21730298 Data show that KCNQ1 mRNA expression was increased and KCNQ5 decreased in the preterm preeclamptic women.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910673 While KCNE1 slows activation and suppresses inward rectification, KCNE3 drastically inhibits KCNQ5 currents.
18786918 among the allowed assembly conformations are KCNQ3/4 and KCNQ4/5 heteromers.
17237198 In conclusion, this work demonstrates that inactivation is a key regulatory mechanism of Kv7.4 and Kv7.5 channels.
15304482 Src associates with KCNQ2-5 subunits but phosphorylates only KCNQ3-5.

AA Sequence

MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGG      1 - 70
GGGGLRESRRGKQGARMSLLGKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGC     71 - 140
LILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIWSAGCCCRYRGWQGRLRFARKPFCVIDTIVL    141 - 210
IASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFS    211 - 280
SFLVYLVEKDANKEFSTYADALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGF    281 - 350
ALKVQEQHRQKHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTKKEQGEASSSQKLS    351 - 420
FKERVRMASPRGQSIKSRQASVGDRRSPSTDITAEGSPTKVQKSWSFNDRTRFRPSLRLKSSQPKPVIDA    421 - 490
DTALGTDDVYDEKGCQCDVSVEDLTPPLKTVIRAIRIMKFHVAKRKFKETLRPYDVKDVIEQYSAGHLDM    491 - 560
LCRIKSLQTRVDQILGKGQITSDKKSREKITAEHETTDDLSMLGRVVKVEKQVQSIESKLDCLLDIYQQV    561 - 630
LRKGSASALALASFQIPPFECEQTSDYQSPVDSKDLSGSAQNSGCLSRSTSANISRGLQFILTPNEFSAQ    631 - 700
TFYALSPTMHSQATQVPISQSDGSAVAATNTIANQINTAPKPAAPTTLQIPPPLPAIKHLPRPETLHPNP    701 - 770
AGLQESISDVTTCLVASKENVQVAQSNLTKDRSMRKSFDMGGETLLSVCPMVPKDLGKSLSVQNLIRSTE    771 - 840
ELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEETETDTFDAAPQPAREAAFASDSLRTGRSRS    841 - 910
SQSICKAGESTDALSLPHVKLK                                                    911 - 932
//

Text Mined References (30)

PMID Year Title
25672891 2015 A genome-wide association study of periodontitis in a Japanese population.
25127363 2014 Application of a combination of a knowledge-based algorithm and 2-stage screening to hypothesis-free genomic data on irinotecan-treated patients for identification of a candidate single nucleotide polymorphism related to an adverse effect.
24855057 2014 Functional assembly of Kv7.1/Kv7.5 channels with emerging properties on vascular muscle physiology.
24297175 2014 Differential protein kinase C-dependent modulation of Kv7.4 and Kv7.5 subunits of vascular Kv7 channels.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22347474 2012 CTCF mediates the cell-type specific spatial organization of the Kcnq5 locus and the local gene regulation.
22190306 2012 Targeting of Kv7.5 (KCNQ5)/KCNE channels to surface microdomains of cell membranes.
21730298 2011 Novel expression and regulation of voltage-dependent potassium channels in placentas from women with preeclampsia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910673 2009 Functional implications of KCNE subunit expression for the Kv7.5 (KCNQ5) channel.
18786918 2008 Homomeric and heteromeric assembly of KCNQ (Kv7) K+ channels assayed by total internal reflection fluorescence/fluorescence resonance energy transfer and patch clamp analysis.
18457656 2008 Expression profile and characterisation of a truncated KCNQ5 splice variant.
17237198 2007 Inactivation as a new regulatory mechanism for neuronal Kv7 channels.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304482 2004 Dual phosphorylations underlie modulation of unitary KCNQ K(+) channels by Src tyrosine kinase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12890507 2003 Localization of KCNQ5 in the normal and epileptic human temporal neocortex and hippocampal formation.
12506198 2003 Disrupted-in-Schizophrenia-1 (DISC-1): mutant truncation prevents binding to NudE-like (NUDEL) and inhibits neurite outgrowth.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12032157 2002 The identification and characterization of a noncontinuous calmodulin-binding site in noninactivating voltage-dependent KCNQ potassium channels.
11159685 2001 Characterization of KCNQ5/Q3 potassium channels expressed in mammalian cells.
10816588 2000 KCNQ5, a novel potassium channel broadly expressed in brain, mediates M-type currents.
10787416 2000 Molecular cloning and functional expression of KCNQ5, a potassium channel subunit that may contribute to neuronal M-current diversity.