Property Summary

NCBI Gene PubMed Count 58
PubMed Score 81.96
PubTator Score 1863.79

Knowledge Summary

Patent (1,796)

Expression

  Differential Expression (9)

Disease log2 FC p
interstitial lung disease 1.200 1.2e-02
glioblastoma 1.900 3.1e-04
medulloblastoma, large-cell 1.100 1.5e-04
colon cancer -2.400 3.7e-06
adult high grade glioma 1.400 8.3e-04
posterior fossa group B ependymoma 1.200 1.4e-04
non-inflammatory breast cancer -3.100 1.8e-06
breast carcinoma -1.600 2.9e-26
ovarian cancer 1.800 2.5e-11

Protein-protein Interaction (3)

Gene RIF (47)

PMID Text
25825713 Data show that two lysine residues that are unique to the N terminus of calcium-activated potassium channel subunit beta-1 were identified to be sufficient for voltage-sensor modulation.
25576871 To determine the relationship between atherosclerosis and KCNMB1, we studied some atherogenic factors affecting vascular tone. Blood of atherosclerotic patients shows increased concentration of 7-ketocholesterol, possibly a harmful lipid to blood vessels.
25275635 The study demonstrates that both transmembrane domains of BKbeta1 are required to provide the characteristic ion current phenotype of beta1-containing BK channels.
24569989 N-terminal isoforms of the large-conductance Ca(2)-activated K channel are differentially modulated by the auxiliary beta1-subunit.
24476761 Bisphenol A activates BK alpha via an extracellular site and that Bisphenol A-sensitivity is increased by the beta1 subunit.
23825428 In large-conductance calcium-dependent potassium channels, beta1 and beta2 subunits alter the voltage sensing domain-cytosolic domain interface.
23255603 The results indicate that the beta1-subunit can form a tripartite complex with TP and MaxiKalpha, has the ability to associate with each protein independently.
22114151 HIF-1alpha increases KCNMB1 expression in response to hypoxia in human pulmonary artery smooth muscle cells by binding to two hypoxia response elements located at -3,540 to -3,311 of the KCNMB1 promoter
21413024 Cloned BK(Ca) channel directly regulated apoptosis and proliferation of HEK293 cell under hyperglycemia condition.
20966391 downregulation of vascular BK-beta(1) expression in diabetes and in high-glucose culture conditions was associated with FOXO-3a/FBXO-dependent increase in BK-beta(1) degradation.
20861615 Here we found that KCNMB1 common variant Glu65Lys influences glomerular filtration rate across multiple populations of different clinical characteristics and biogeographic ancestries.
20861615 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20457834 In transfected HEK293 cells, activation of cloned BK(Ca) channel induced apoptosis, whereas inhibition of cloned BK(Ca) channel decreased apoptosis.
20424473 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19801679 Results reveal the first ion channel subunit as a direct target of SRF-MYOCD transactivation, providing further insight into the role of MYOCD as a master regulator of the SMC contractile phenotype.
19430934 The expressed hSloalpha + beta1 subunit complex demonstrated to be fully functional for its typical single-channel traces, Ca(2+)-sensitivity, voltage-dependency, high conductance (151 +/- 7 pS), and its pharmacological activation and inhibition.
19295429 genetic polymorphism shows sex-specific association with asthma severity in male african population
19289549 Cell membrane stretch and cell volume sensitivity are independently regulated by KCNMB1 (BK) and KCNQ1 channels, respectively.
19282863 Observational study of gene-disease association. (HuGE Navigator)
19204046 Report beta subunit (KNMB1-4)-specific modulations of BK channel function by a Slo1 mutation associated with epilepsy and dyskinesia.
19057512 maxi-K(+) beta1-subunit could contribute to vascular dysregulation in severe obstructive sleep apnea syndrome patients. Leukocyte beta1 expression may be independent readout of hypoxemia that could be useful as molecular marker for impending hypertension.
19050450 The KCNMB1 E65K variant is associated with reduced central pulse pressure.
19050450 Observational study of gene-disease association. (HuGE Navigator)
18854753 The findings suggest that the KCNMB1 Glu65Lys polymorphism associates with reduced systolic and diastolic blood pressure in middle-aged men.
18854753 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18535015 African American male asthmatics carrying the KCNMB1 818T allele (10% of population) are potentially at risk for greater airway obstruction and increased asthma morbidity.
18535015 Observational study of gene-disease association. (HuGE Navigator)
18496125 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18418400 The protective effect of KCNMB1 E65K against hypertension is restricted to blood pressure treatment with beta-blockade.
17700361 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17496725 Observational study of genotype prevalence. (HuGE Navigator)
17496725 identified and characterized single nucleotide polymorphisms in the exons, intron/exon junctions, upstream region and 3' untranslated regions of KCNMB1 using denaturing high-performance liquid chromatography combined with direct DNA sequencing
16446507 results reveal the molecular regions in the beta1 and beta2 subunits that determine their differential functional coupling with the pore-forming alpha-subunit
16293791 Observational study of gene-disease association. (HuGE Navigator)
16155733 Observational study of gene-disease association. (HuGE Navigator)
15671602 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15528406 Hemoxygenase-2 is part of the BK channel complex and enhances channel activity in normoxia
14522958 Chronic hypoxia caused no change in alpha-subunit but evoked a 3-fold increase in beta-subunit expression, and augmented alpha/beta-subunit co-localization at the plasma membrane; maxiK channel function is modulated via post-transcriptional mechanisms.
12962281 We conclude that transient membrane current is generated by a mechanism related to the deactivation, and level of prior activation, of glioma BK channels.
12893878 Beta1 subunits facilitate gating of BK channels by acting through the Ca2+, but not the Mg2+, activating mechanisms.
12670831 mesangial cells contain hbeta1, a BK accessory protein, which confers activation of BK by cGMP kinase.
12223479 pore-forming alpha subunit of the hSlo channel promotes N-linked glycosylation of its auxiliary beta4 subunit, and this in turn influences the modulation of the channel by the beta4 subunit
12011654 have a reset baroreflex. Variants in the gene (KCNMB1) coding for the BK beta1 subunit are associated with baroreflex function.
11790768 Phosphorylation-dependent functional coupling of hSlo and its hbeta 4 subunit

AA Sequence

MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKK      1 - 70
VPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSVDNYQTARADVEKVRAKFQEQQVFYCFSAPR     71 - 140
GNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKSNQYLSILAAQK                       141 - 191
//

Text Mined References (59)

PMID Year Title
25825713 2015 Molecular mechanism underlying ?1 regulation in voltage- and calcium-activated potassium (BK) channels.
25825171 2015 Two distinct effects of PIP2 underlie auxiliary subunit-dependent modulation of Slo1 BK channels.
25576871 2015 7-Ketocholesterol induces the reduction of KCNMB1 in atherosclerotic blood vessels.
25275635 2014 Both transmembrane domains of BK ?1 subunits are essential to confer the normal phenotype of ?1-containing BK channels.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24569989 2014 N-terminal isoforms of the large-conductance Ca²?-activated K? channel are differentially modulated by the auxiliary ?1-subunit.
24476761 2014 Bisphenol A activates BK channels through effects on ? and ?1 subunits.
23825428 2013 The interface between membrane-spanning and cytosolic domains in Ca²+-dependent K+ channels is involved in ? subunit modulation of gating.
23255603 2013 The ?1-subunit of the MaxiK channel associates with the thromboxane A2 receptor and reduces thromboxane A2 functional effects.
22114151 2012 Hypoxia-inducible factor-1? regulates KCNMB1 expression in human pulmonary artery smooth muscle cells.
21413024 2011 High glucose alters apoptosis and proliferation in HEK293 cells by inhibition of cloned BK Ca channel.
20966391 2010 Muscle-specific f-box only proteins facilitate bk channel ?(1) subunit downregulation in vascular smooth muscle cells of diabetes mellitus.
20861615 2010 Common charge-shift mutation Glu65Lys in K+ channel ??-Subunit KCNMB1: pleiotropic consequences for glomerular filtration rate and progressive renal disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20457834 2010 Activation of BKCa channel is associated with increased apoptosis of cerebrovascular smooth muscle cells in simulated microgravity rats.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19801679 2009 The smooth muscle cell-restricted KCNMB1 ion channel subunit is a direct transcriptional target of serum response factor and myocardin.
19430934 2009 Coexpression and characterization of the human large-conductance Ca(2+)-activated K (+) channel alpha + beta1 subunits in HEK293 cells.
19295429 2009 Gene-environmental interaction in the development of atopic asthma: new developments.
19289549 2009 Cell volume and membrane stretch independently control K+ channel activity.
19282863 2009 Association of candidate gene polymorphisms with chronic kidney disease in Japanese individuals with hypertension.
19204046 2009 {beta} subunit-specific modulations of BK channel function by a mutation associated with epilepsy and dyskinesia.
19057512 2009 Maxi-K+ channel beta1 expression in sleep apnea patients and its modulation by CPAP treatment.
19050450 2009 The KCNMB1 E65K variant is associated with reduced central pulse pressure in the community-based Framingham Offspring Cohort.
18854753 2008 The KCNMB1 Glu65Lys polymorphism associates with reduced systolic and diastolic blood pressure in the Inter99 study of 5729 Danes.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18535015 2008 An african-specific functional polymorphism in KCNMB1 shows sex-specific association with asthma severity.
18496125 2008 Interactions among genetic variants from contractile pathway of vascular smooth muscle cell in essential hypertension susceptibility of Chinese Han population.
18418400 2008 The protective effect of KCNMB1 E65K against hypertension is restricted to blood pressure treatment with beta-blockade.
17700361 2007 KCNMB1 genotype influences response to verapamil SR and adverse outcomes in the INternational VErapamil SR/Trandolapril STudy (INVEST).
17496725 2007 Single nucleotide polymorphism discovery and haplotype analysis of Ca2+-dependent K+ channel beta-1 subunit.
16446507 2006 Structural determinants for functional coupling between the beta and alpha subunits in the Ca2+-activated K+ (BK) channel.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16293791 2005 Protective effect of the KCNMB1 E65K genetic polymorphism against diastolic hypertension in aging women and its relevance to cardiovascular risk.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16155733 2005 E65 K polymorphism in KCNMB1 gene is not associated with ischaemic heart disease in Spanish patients.
15671602 2005 Association analysis between hypertension and CYBA, CLCNKB, and KCNMB1 functional polymorphisms in the Japanese population--the Suita Study.
15528406 2004 Hemoxygenase-2 is an oxygen sensor for a calcium-sensitive potassium channel.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057310 2004 Gain-of-function mutation in the KCNMB1 potassium channel subunit is associated with low prevalence of diastolic hypertension.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14522958 2003 Post-transcriptional control of human maxiK potassium channel activity and acute oxygen sensitivity by chronic hypoxia.
12962281 2003 Current transients associated with BK channels in human glioma cells.
12893878 2003 Beta1 subunits facilitate gating of BK channels by acting through the Ca2+, but not the Mg2+, activating mechanisms.
12670831 2003 Role of hbeta1 in activation of human mesangial BK channels by cGMP kinase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12434576 2002 Calcium-activated potassium channel expression in human myometrium: effect of pregnancy.
12223479 2002 Reciprocal modulation between the alpha and beta 4 subunits of hSlo calcium-dependent potassium channels.
12136044 2002 New disguises for an old channel: MaxiK channel beta-subunits.
12011654 2002 The BK channel beta1 subunit gene is associated with human baroreflex and blood pressure regulation.
11994272 2002 The large conductance potassium channel beta-subunit can interact with and modulate the functional properties of a calcium-activated chloride channel, CLCA1.
11790768 2002 Phosphorylation-dependent functional coupling of hSlo calcium-dependent potassium channel and its hbeta 4 subunit.
10792058 2000 A neuronal beta subunit (KCNMB4) makes the large conductance, voltage- and Ca2+-activated K+ channel resistant to charybdotoxin and iberiotoxin.
10489376 1999 Acute activation of Maxi-K channels (hSlo) by estradiol binding to the beta subunit.
9888999 1999 Human and rodent MaxiK channel beta-subunit genes: cloning and characterization.
8799178 1996 Cloning, expression, and distribution of a Ca(2+)-activated K+ channel beta-subunit from human brain.
8764643 1996 Phenotypic alteration of a human BK (hSlo) channel by hSlobeta subunit coexpression: changes in blocker sensitivity, activation/relaxation and inactivation kinetics, and protein kinase A modulation.
8612769 1996 A calcium switch for the functional coupling between alpha (hslo) and beta subunits (KV,Ca beta) of maxi K channels.