Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.94
PubTator Score 6.55

Knowledge Summary

Patent (496)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.600 2.0e-03
ependymoma -3.800 2.7e-25
glioblastoma -3.300 2.9e-08
oligodendroglioma -1.200 7.5e-13
group 4 medulloblastoma -3.600 7.6e-10
atypical teratoid/rhabdoid tumor -2.900 1.4e-10
medulloblastoma, large-cell -2.100 5.6e-04
primitive neuroectodermal tumor -2.500 3.0e-05
adult high grade glioma -3.400 2.2e-08
pilocytic astrocytoma -1.200 5.5e-04
subependymal giant cell astrocytoma 2.745 6.4e-03
progressive supranuclear palsy 1.300 1.7e-02

Gene RIF (4)

PMID Text
25148687 In cell and tissues co-expressing THIK1 and THIK2, heterodimeric channels may contribute to cell excitability.
24163367 The cytoplasmic amino-terminal region of THIK2 (Nt-THIK2) contains an arginine-rich motif (RRSRRR) that acts as a retention/retrieval signal.
18676988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18209473 THIK-1 and THIK-2 are abundantly expressed in the proximal and distal nephron of the mammalian kidney.

AA Sequence

MSSRSPRPPPRRSRRRLPRPSCCCCCCRRSHLNEDTGRFVLLAALIGLYLVAGATVFSALESPGEAEARA      1 - 70
RWGATLRNFSAAHGVAEPELRAFLRHYEAALAAGVRADALRPRWDFPGAFYFVGTVVSTIGFGMTTPATV     71 - 140
GGKAFLIAYGLFGCAGTILFFNLFLERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADSLAGWK    141 - 210
PSVYHVLLILGLFAVLLSCCASAMYTSVEGWDYVDSLYFCFVTFSTIGFGDLVSSQHAAYRNQGLYRLGN    211 - 280
FLFILLGVCCIYSLFNVISILIKQVLNWMLRKLSCRCCARCCPAPGAPLARRNAITPGSRLRRRLAALGA    281 - 350
DPAARDSDAEGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGFSGGVGALGIMN    351 - 420
NRLAETSASR                                                                421 - 430
//

Text Mined References (11)

PMID Year Title
25148687 2014 Tandem pore domain halothane-inhibited K+ channel subunits THIK1 and THIK2 assemble and form active channels.
24163367 2013 Silencing of the tandem pore domain halothane-inhibited K+ channel 2 (THIK2) relies on combined intracellular retention and low intrinsic activity at the plasma membrane.
19890347 2010 Genome-wide association study of generalized vitiligo in an isolated European founder population identifies SMOC2, in close proximity to IDDM8.
18676988 2008 A high-density association screen of 155 ion transport genes for involvement with common migraine.
18209473 2008 Cellular localization of THIK-1 (K(2P)13.1) and THIK-2 (K(2P)12.1) K channels in the mammalian kidney.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11263999 2001 Genomic and functional characteristics of novel human pancreatic 2P domain K(+) channels.
11256078 2001 Potassium leak channels and the KCNK family of two-P-domain subunits.
11060316 2001 THIK-1 and THIK-2, a novel subfamily of tandem pore domain K+ channels.