Property Summary

Ligand Count 114
NCBI Gene PubMed Count 349
PubMed Score 1853.61
PubTator Score 774.13

Knowledge Summary

Patent (24,095)


  Disease (8)

Disease Target Count
diabetes mellitus 1728
Hypoglycemia 152
Epilepsy 792
Hyperglycemia 137
Abnormality of fatty-acid metabolism 6
Abnormality of the immune system 18
Abnormality of the pancreatic islet cells 4
Anteverted nostril 191
Arthrogryposis 54
Autosomal recessive predisposition 1442
Axial hypotonia 46
Beta-cell dysfunction 5
Bilateral ptosis 9
Blepharoptosis 231
Cognitive delay 608
Comatose 56
Congenital Heart Defects 58
Congenital clinodactyly 57
Congenital ear anomaly NOS (disorder) 29
Congenital heart disease 93
Contracture of lower limb 6
Curvature of digit 57
Dehydration 40
Diabetes Mellitus, Insulin-Dependent 48
Diabetes Mellitus, Non-Insulin-Dependent 145
Diabetes Mellitus, Transient Neonatal, 1 4
Diarrhea 253
Downturned corners of mouth 48
Dull intelligence 645
Elevated heart rate 25
Epilepsies, Myoclonic 32
Failure to gain weight 365
Fatty acids abnormal 6
Fetal Growth Retardation 189
Generalized myoclonic seizures 30
Gestational diabetes 26
Global developmental delay 608
Glycosuria 29
Hepatomegaly 285
High urine albumin levels 5
Hyperhidrosis disorder 81
Hyperinsulinaemic hypoglycaemia 16
Hyperinsulinemic hypoglycemia, familial, 2 1
Hypoketotic hypoglycemia 11
Hypovolemia 8
Hypsarrhythmia 25
Increased HbA1c levels 2
Increased sweating 81
Infant, Small for Gestational Age 176
Intellectual disability 1016
Intrauterine retardation 176
Islets of Langerhans hyperplasia 11
Ketoacidosis 11
Ketonuria 8
Large for gestational age 11
Lethargy 77
Limb contractures 6
Long philtrum 137
Low Birth Weights 69
Low intelligence 645
Maturity onset diabetes mellitus in young 11
Mental Retardation 645
Mental and motor retardation 608
Mental deficiency 645
Microalbuminuria 5
Mild global developmental delay 14
Motor delay 147
Muscle Weakness 170
Myoclonic Epilepsies, Progressive 44
Neonatal hypoglycemia 17
Neonatal insulin-dependent diabetes mellitus 6
Neuropathy 261
No development of motor milestones 147
Pallor 40
Pediatric failure to thrive 365
Peripheral Neuropathy 134
Poor school performance 645
Progressive neurologic deterioration 19
Prominent metopic ridge 15
Psychomotor retardation, mild 14
Radially deviated fingers 38
Reduced pancreatic beta cells 6
Retinal Diseases 55
Short nose 132
Small for gestational age (disorder) 69
Small head 374
Small nose 132
Sweating 81
Tachycardia 43
Thiamine Deficiency 4
Tonic - clonic seizures 44
Vomiting 116
Weight decreased 103
maternal hyperglycemia 3
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 3.0
Disease Target Count Z-score Confidence
Hyperinsulinemic hypoglycemia 17 5.391 2.7


Protein-protein Interaction (2)

Gene RIF (344)

AA Sequence

EDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS                                  351 - 390

Text Mined References (353)

PMID Year Title