Property Summary

Ligand Count 4
NCBI Gene PubMed Count 8
PubMed Score 4.85
PubTator Score 1.67

Knowledge Summary

Patent (17,499)

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer -2.500 7.0e-39
ependymoma -1.100 1.8e-03
glioblastoma multiforme -1.300 1.3e-10
group 3 medulloblastoma 1.500 4.3e-02
intraductal papillary-mucinous adenoma (... 2.100 4.7e-05
intraductal papillary-mucinous carcinoma... 1.500 7.1e-03
intraductal papillary-mucinous neoplasm ... 1.800 9.8e-04
lung carcinoma 1.500 1.2e-16
osteosarcoma -1.980 3.0e-06
Pick disease -2.600 1.1e-04
pituitary cancer -1.500 1.3e-02
progressive supranuclear palsy -2.500 1.1e-02
psoriasis -1.200 6.8e-24
tuberculosis and treatment for 3 months 1.200 1.2e-02

Gene RIF (2)

AA Sequence

MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEVMQKSCSCKFL      1 - 70
FGVETNEQLMLQIEKSLEEKTEFKGEIMFYKKNGSPFWCLLDIVPIKNEKGDVVLFLASFKDITDTKVKI     71 - 140
TPEDKKEDKVKGRSRAGTHFDSARRRSRAVLYHISGHLQRREKNKLKINNNVFVDKPAFPEYKVSDAKKS    141 - 210
KFILLHFSTFKAGWDWLILLATFYVAVTVPYNVCFIGNDDLSTTRSTTVSDIAVEILFIIDIILNFRTTY    211 - 280
VSKSGQVIFEARSICIHYVTTWFIIDLIAALPFDLLYAFNVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQ    281 - 350
HSTIVLTLLMSMFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSA    351 - 420
YIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRWSLYHTRTKDL    421 - 490
KDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITMHLNKEILQLSLFECASRGCL    491 - 560
RSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLKDSMVLAILGKGDLIGANLSIKDQVIKTNAD    561 - 630
VKALTYCDLQCIILKGLFEVLDLYPEYAHKFVEDIQHDLTYNLREGHESDVISRLSNKSMVSQSEPKGNG    631 - 700
NINKRLPSIVEDEEEEEEGEEEEAVSLSPICTRGSSSRNKKVGSNKAYLGLSLKQLASGTVPFHSPIRVS    701 - 770
RSNSPKTKQEIDPPNHNKRKEKNLKLQLSTLNNAGPPDLSPRIVDGIEDGNSSEESQTFDFGSERIRSEP    771 - 840
RISPPLGDPEIGAAVLFIKAEETKQQINKLNSEVTTLTQEVSQLGKDMRNVIQLLENVLSPQQPSRFCSL    841 - 910
HSTSVCPSRESLQTRTSWSAHQPCLHLQTGGAAYTQAQLCSSNITSDIWSVDPSSVGSSPQRTGAHEQNP    911 - 980
ADSELYHSPSLDYSPSHYQVVQEGHLQFLRCISPHSDSTLTPLQSISATLSSSVCSSSETSLHLVLPSRS    981 - 1050
EEGSFSQGTVSSFSLENLPGSWNQEGMASASTKPLENLPLEVVTSTAEVKDNKAINV                1051 - 1107
//

Text Mined References (10)

PMID Year Title