Property Summary

NCBI Gene PubMed Count 25
PubMed Score 17.28
PubTator Score 17.91

Knowledge Summary

Patent (3,889)

TINX Plot

  Disease (4)

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.300 1.1e-05
pilocytic astrocytoma -1.100 2.4e-08
ovarian cancer -1.200 3.0e-05

Gene RIF (12)

PMID Text
26258683 EAG2 potassium channel has an evolutionarily conserved function for promoting brain tumor growth.
25542181 The observed Ca(2+)-induced proteolytic cleavage of EAG2 channel may act as an adaptive response under physiological and/or pathological conditions.
24759919 Study propose that hypomethylation of the placental-specific KCNH5 promoter is frequently associated with KCNH5 expression in melanoma cells.
24133262 Our results demonstrate the critical role of the Arg327 residue in stabilizing the channel closed state and explicate for the first time the structural and functional change of a Kv10.2 channel mutation associated with neurological disease.
23647072 This study performed whole exome sequencing demonistrated that the true de novo variants represent mutations in genes (KCNH5, CLCN4, and ARHGEF15) not previously associated with epilepsies in humans.
22792721 Three-dimensional structure of human Kv10.2 ion channel studied by single particle electron microscopy and molecular modeling
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19850283 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19172261 data suggest that the 'Per-Ant-Sim' (PAS) and cyclic nucleotide binding (cNBD) domains at the N- and C-termini form interacting oligomers that have roles in channel function
18349282 Methylation of KCNH5 was present in 80% of NSCLC tissues but only in 14% of noncancerous tissues.
12135768 molecular identification and characterisation

AA Sequence

MPGGKRGLVAPQNTFLENIVRRSSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQKSSTCSFMYG      1 - 70
ELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIED     71 - 140
DSTKGWTKFARLTRALTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHY    141 - 210
CAFKTTWDWVILILTFYTAIMVPYNVSFKTKQNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISD    211 - 280
PKLIRMNYLKTWFVIDLLSCLPYDIINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLV    281 - 350
LLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYV    351 - 420
SSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEMLNNVRD    421 - 490
FLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHLNRKVFNEHPAFRLASDGCLR    491 - 560
ALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQDDEVVAILGKGDVFGDIFWKETTLAHACANV    561 - 630
RALTYCDLHIIKREALLKVLDFYTAFANSFSRNLTLTCNLRKRIIFRKISDVKKEEEERLRQKNEVTLSI    631 - 700
PVDHPVRKLFQKFKQQKELRNQGSTQGDPERNQLQVESRSLQNGASITGTSVVTVSQITPIQTSLAYVKT    701 - 770
SESLKQNNRDAMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKNNMGAHEEKKEDWNNVTKAESMGLL    771 - 840
SEDPKSSDSENSVTKNPLRKTDSCDSGITKSDLRLDKAGEARSPLEHSPIQADAKHPFYPIPEQALQTTL    841 - 910
QEVKHELKEDIQLLSCRMTALEKQVAEILKILSEKSVPQASSPKSQMPLQVPPQIPCQDIFSVSRPESPE    911 - 980
SDKDEIHF                                                                  981 - 988
//

Text Mined References (27)

PMID Year Title
26503718 2015 Bimodal regulation of an Elk subfamily K+ channel by phosphatidylinositol 4,5-bisphosphate.
26258683 2015 EAG2 potassium channel with evolutionarily conserved function as a brain tumor target.
25542181 2015 A sustained increase in the intracellular Ca²? concentration induces proteolytic cleavage of EAG2 channel.
25293881 2015 The contribution of common genetic variation to nicotine and cotinine glucuronidation in multiple ethnic/racial populations.
24759919 2014 Retrotransposon hypomethylation in melanoma and expression of a placenta-specific gene.
24348519 2013 EMR-linked GWAS study: investigation of variation landscape of loci for body mass index in children.
24133262 2013 Multistate structural modeling and voltage-clamp analysis of epilepsy/autism mutation Kv10.2-R327H demonstrate the role of this residue in stabilizing the channel closed state.
23647072 2013 Exome sequencing reveals new causal mutations in children with epileptic encephalopathies.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
22855790 2012 Voltage-gated potassium channel EAG2 controls mitotic entry and tumor growth in medulloblastoma via regulating cell volume dynamics.
22792721 [Three-dimensional structure of human Kv10.2 ion channel studied by single particle electron microscopy and molecular modeling].
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19850283 2010 Identification of novel candidate genes for treatment response to risperidone and susceptibility for schizophrenia: integrated analysis among pharmacogenomics, mouse expression, and genetic case-control association approaches.
19172261 2009 Roles of surface residues of intracellular domains of heag potassium channels.
18655026 2008 Proteomic analysis of ubiquitinated proteins in normal hepatocyte cell line Chang liver cells.
18349282 2008 DNA methylation in tumor and matched normal tissues from non-small cell lung cancer patients.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12135768 2002 Molecular identification and characterisation of the human eag2 potassium channel.
11943152 2002 Functional distinction of human EAG1 and EAG2 potassium channels.
10524757 1998 Sequencing analysis of forty-eight human image cDNA clones similar to Drosophila mutant protein.