Property Summary

Ligand Count 14
NCBI Gene PubMed Count 89
PubMed Score 714.16
PubTator Score 221.85

Knowledge Summary

Patent (19,282)

TINX Plot

  Disease (8)

Disease Target Count
Absent nail of hallux 1
Acquired scoliosis 281
Adducted thumb 22
Aortic arch dilatation 3
Aortic root dilatation 11
Autosomal recessive predisposition 1442
Broad flat nasal bridge 236
Broad hallux 29
Broad thumbs 28
Bushy eyebrows 49
Byzanthine arch palate 194
Cardiomyopathies 110
Cataract 297
Coarse facial features 108
Cognitive delay 608
Concave bridge of nose 195
Congenital Epicanthus 177
Curvature of spine 282
Depressed nasal bridge 195
Depressed nasal root/bridge 195
Downturned corners of mouth 48
Fibromatosis, Gingival 8
Flat forehead 5
Full lower lip 64
Gingival Hyperplasia 34
Gingival Hypertrophy 34
Gingival Overgrowth 36
Global developmental delay 608
Hepatomegaly 285
Hereditary gingival fibromatosis 8
Hirsutism 47
Hyperextensible digits 7
Hypoplastic thumbnail 1
Idiopathic gingival hyperplasia 8
Increased size of penis 7
Infantile onset 238
Late tooth eruption 61
Lens Opacities 231
Long philtrum 137
Macrostomia 72
Mammary Neoplasms 425
Mental and motor retardation 608
Micronychia (disorder) 24
Muscle hypotonia 571
Myopathic facies 13
Myopia 176
Nasal bridge wide 236
Orbital separation excessive 244
Patent ductus arteriosus 90
Posteriorly rotated ear 61
Progressive mental retardation 37
Prominent lower lip 64
Pseudoepiphysis of the thumb 1
Schizophrenia 1160
Seizures 596
Severe mental retardation (I.Q. 20-34) 99
Short distal phalanges 50
Short distal phalanx of toe 2
Spina bifida occulta 19
Splenomegaly 190
Synophrys 40
Thick nasal alae 5
Thickened facial skin with coarse facial features 108
Umbilical hernia 93
Wide nose 35
abnormal growth 26
Disease Target Count P-value
psoriasis 6694 9.7e-19
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
lung cancer 4740 0.0 0.6
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0
Disease Target Count
Zimmermann-Laband syndrome 2

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 9.7e-19

Gene RIF (74)

AA Sequence

MTMAGGRRGLVAPQNTFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFM      1 - 70
YGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFKQPI     71 - 140
EDDSCKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHII    141 - 210
LHYCVFKTTWDWIILILTFYTAILVPYNVSFKTRQNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEV    211 - 280
ISDPKLIRMNYLKTWFVIDLLSCLPYDVINAFENVDEVSAFMGDPGKIGFADQIPPPLEGRESQGISSLF    281 - 350
SSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLY    351 - 420
QLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIGSLL    421 - 490
YATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTEKVLQICP    491 - 560
KDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLEVIQ    561 - 630
DDEVVAILGKGDVFGDVFWKEATLAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYN    631 - 700
LRKRIVFRKISDVKREEEERMKRKNEAPLILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGN    701 - 770
VLTEHASANHSLVKASVVTVRESPATPVSFQAASTSGVPDHAKLQAPGSECLGPKGGGGDCAKRKSWARF    771 - 840
KDACGKSEDWNKVSKAESMETLPERTKASGEATLKKTDSCDSGITKSDLRLDNVGEARSPQDRSPILAEV    841 - 910
KHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPE    911 - 980
SERDIFGAS                                                                 981 - 989
//

Text Mined References (92)

PMID Year Title