Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.71
PubTator Score 7.45

Knowledge Summary

Patent (1,898)

TINX Plot

Expression

Gene RIF (3)

PMID Text
22438204 The authors conclude that K(v) 1.7 contributes to the membrane-repolarizing current of beta cells during glucose-stimulated insulin.
15639836 Observational study of genotype prevalence. (HuGE Navigator)
11896454 Expressed in heart, but not the cause of progressive familial heart block I.

AA Sequence

MEPRCPPPCGCCERLVLNVAGLRFETRARTLGRFPDTLLGDPARRGRFYDDARREYFFDRHRPSFDAVLY      1 - 70
YYQSGGRLRRPAHVPLDVFLEEVAFYGLGAAALARLREDEGCPVPPERPLPRRAFARQLWLLFEFPESSQ     71 - 140
AARVLAVVSVLVILVSIVVFCLETLPDFRDDRDGTGLAAAAAAGPFPAPLNGSSQMPGNPPRLPFNDPFF    141 - 210
VVETLCICWFSFELLVRLLVCPSKAIFFKNVMNLIDFVAILPYFVALGTELARQRGVGQQAMSLAILRVI    211 - 280
RLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVVLFSSAVYFAEVDRVDSHFTSIPESFW    281 - 350
WAVVTMTTVGYGDMAPVTVGGKIVGSLCAIAGVLTISLPVPVIVSNFSYFYHRETEGEEAGMFSHVDMQP    351 - 420
CGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV                                      421 - 456
//

Text Mined References (7)

PMID Year Title
22438204 2012 Block of Kv1.7 potassium currents increases glucose-stimulated insulin secretion.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
15639836 2003 [Distribution and significance of cSNP in KCNA7 gene as a novel NIDDM candidate gene in the population of northeast China].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11896454 2002 Characterisation of the human voltage-gated potassium channel gene, KCNA7, a candidate gene for inherited cardiac disorders, and its exclusion as cause of progressive familial heart block I (PFHBI).
11368907 2001 Initial isolation and analysis of the human Kv1.7 (KCNA7) gene, a member of the voltage-gated potassium channel gene family.
9488722 1998 Genomic organization, chromosomal localization, tissue distribution, and biophysical characterization of a novel mammalian Shaker-related voltage-gated potassium channel, Kv1.7.