Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.41
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (1)

AA Sequence

MASETHNVKKRNFCNKIEDHFIDLPRKKISNFTNKNMKEVKKSPKQLAAYINRTVGQTVKSPDKLRKVIY      1 - 70
RRKKVHHPFPNPCYRKKQSPGSGGCDMANKENELACAGHLPEKLHHDSRTYLVNSSDSGSSQTESPSSKY     71 - 140
SGFFSEVSQDHETMAQVLFSRNMRLNVALTFWRKRSISELVAYLLRIEDLGVVVDCLPVLTNCLQEEKQY    141 - 210
ISLGCCVDLLPLVKSLLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIINDGNIQILKQQLSGLWEQEN    211 - 280
HLTLVPGYTGNIAKDVDAYLLQLH                                                  281 - 304
//

Text Mined References (13)

PMID Year Title