Property Summary

NCBI Gene PubMed Count 44
PubMed Score 102.53
PubTator Score 62.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.200 2.3e-05
psoriasis -1.300 5.4e-04
astrocytoma 1.400 5.3e-03
atypical teratoid / rhabdoid tumor 1.400 1.6e-04
glioblastoma 1.300 2.0e-03
group 4 medulloblastoma 1.700 4.5e-04
medulloblastoma, large-cell 1.700 7.3e-06
primary pancreatic ductal adenocarcinoma 1.373 1.3e-02
tuberculosis -1.100 1.2e-06
lung cancer -1.200 1.0e-03
Breast cancer 2.900 4.8e-02
ovarian cancer 2.000 6.6e-05
pancreatic cancer 1.100 4.4e-02

Protein-protein Interaction (5)

Gene RIF (29)

PMID Text
26667788 In this study we report the frequency of FGFR1 and KAT6A involvement in patients with hematological malignancies and 8p11 abnormalities.
25922517 findings establish that MOZ and BMI1 play opposing roles during the onset of Hox gene expression in the ES cell model and during body segment identity specification in vivo.
25728777 Heterozygous truncating mutations in KAT6A, as well as deletions of the same locus, cause a syndrome characterized by intellectual disability, craniosynostosis, cardiac defects, feeding difficulties, and distinct facial features.
25728775 We have identified KAT6A mutations as a frequent cause of syndromic developmental delay with microcephaly and dysmorphic features.
25220592 These data suggest that KAT6A may be a novel oncogene in breast cancers bearing the 8p11-p12 amplicon.
24258712 MOZ-TIF2/BRPF1 complex upregulates HOX genes mediated by MOZ-dependent histone acetylation, leading to the development of leukemia.
24150941 The double PHD finger domain of MOZ/MYST3 induces alpha-helical structure of the histone H3 tail to facilitate acetylation and methylation sampling and modification.
23994619 Symplekin interacts and co-localizes with both MOZ and MLL in immature hematopoietic cells. Its inhibition leads to a decrease of the HOXA9 protein level but not of Hoxa9 mRNA.
23431171 MOZ is an acetyltransferase of p53 at K120 and K382 and colocalizes with p53 in promyelocytic leukemia (PML) nuclear bodies following cellular stress.
23347099 Studies indicate the critical function of MOZ (MYST3 or KAT6A(1)) in haematopoiesis.
23063713 These data suggest that the tandem of plant homeodomain 1/2 fingers play a role in MOZ and MORF histone acetyltransferase association with histon H3 regions enriched in acetylated marks.
23022987 MYST3-CREBBP rearrangement harbors a distinctive microRNA signature targeting RET proto-oncogene in acute myeloid leukemia with translocation (8;16)(p11;p13).
22713874 PHD12 facilitates the localization of MOZ onto the promoter locus of the HOXA9 gene, thereby promoting the H3 acetylation around the promoter region.
21880731 Recognition of unmodified histone H3 by the first PHD finger of bromodomain-PHD finger protein 2 provides insights into the regulation of histone acetyltransferases monocytic leukemic zinc-finger protein (MOZ) and MOZ-related factor (MORF).
20800603 Observational study of gene-disease association. (HuGE Navigator)
20581860 The role of the interaction between MOZ and MLL in CD34+ cells in which both proteins have a critical role in hematopoietic cell-fate decision.
19001415 Monocytic leukemia zinc finger (MOZ) interacts with p53 to induce p21 expression and cell-cycle arrest.
18854154 Knockdown of K(lysine) acetyltransferase 6A (KAT6A) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18818702 a gain of the MYB locus, was found recurrently and only in the MYST3-linked AMLs (7/18 vs 0/34). MYST3-AMLs have also a specific a gene expression profile, which includes overexpression of MYB, CD4 and HOXA genes
18794358 These findings indicate that BRPF proteins play a key role in assembling and activating MOZ/MORF acetyltransferase complexes.
18754862 MOZ is essential for the generation and maintenance of hematopoietic stem cells (HSC) and for the appropriate development of myeloid, erythroid and B-lineage cell progenitors.
18528428 MYST3 rearrangement was associated with a poor prognosis, as 50% of patients deceased during the first 10 months
17805331 A MYST3-NCOA3 gene fusion was found in AML-M5. The breakpoint in MYST3 occurs in intron-17.
17296583 analysis of MYST3-CBP fusion transcripts in t(8;16)(p11;p13) acute myeloid leukemias
17182677 Cellular acetyltransferase binds HIV-1 integrase both in vitro and in cells and acetylates three specific lysine's (K264, K266, K273) in the carboxy-terminus of integrase
16613851 MOZ-TIF2 associates with the RARbeta2 promoter in vivo, resulting in altered recruitment of CBP/p300, aberrant histone modification, and down-regulation of the RARbeta2 gene
16096645 Cellular acetyltransferase binds HIV-1 integrase both in vitro and in cells and acetylates three specific lysine's (K264, K266, K273) in the carboxy-terminus of integrase
15657427 MOZ-TIF2 oncogenic fusion protein suppresses transcription by nuclear receptors and p53
12676584 MOZ complexes with TIF2 as a recombinant fusion protein which induces acute myelocytic leukemia.

AA Sequence

MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTILKVSNKGLNS      1 - 70
YKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAA     71 - 140
SGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGKESCESLSCLPPVSLLPHEKDKPVAEPIPICS    141 - 210
FCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLF    211 - 280
CDSCDRGFHMECCDPPLTRMPKGMWICQICRPRKKGRKLLQKKAAQIKRRYTNPIGRPKNRLKKQNTVSK    281 - 350
GPFSKVRTGPGRGRKRKITLSSQSASSSSEEGYLERIDGLDFCRDSNVSLKFNKKTKGLIDGLTKFFTPS    351 - 420
PDGRKARGEVVDYSEQYRIRKRGNRKSSTSDWPTDNQDGWDGKQENEERLFGSQEIMTEKDMELFRDIQE    421 - 490
QALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKC    491 - 560
GWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVG    561 - 630
YFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVIL    631 - 700
ECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVD    701 - 770
PECLRWTPVIVSNSVVSEEEEEEAEEGENEEPQCQERELEISVGKSVSHENKEQDSYSVESEKKPEVMAP    771 - 840
VSSTRLSKQVLPHDSLPANSQPSRRGRWGRKNRKTQERFGDKDSKLLLEETSSAPQEQYGECGEKSEATQ    841 - 910
EQYTESEEQLVASEEQPSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKCRLTEGSERLPRRYSEGDRAV    911 - 980
LRGFSESSEEEEEPESPRSSSPPILTKPTLKRKKPFLHRRRRVRKRKHHNSSVVTETISETTEVLDEPFE    981 - 1050
DSDSERPMPRLEPTFEIDEEEEEEDENELFPREYFRRLSSQDVLRCQSSSKRKSKDEEEDEESDDADDTP   1051 - 1120
ILKPVSLLRKRDVKNSPLEPDTSTPLKKKKGWPKGKSRKPIHWKKRPGRKPGFKLSREIMPVSTQACVIE   1121 - 1190
PIVSIPKAGRKPKIQESEETVEPKEDMPLPEERKEEEEMQAEAEEAEEGEEEDAASSEVPAASPADSSNS   1191 - 1260
PETETKEPEVEEEEEKPRVSEEQRQSEEEQQELEEPEPEEEEDAAAETAQNDDHDADDEDDGHLESTKKK   1261 - 1330
ELEEQPTREDVKEEPGVQESFLDANMQKSREKIKDKEETELDSEEEQPSHDTSVVSEQMAGSEDDHEEDS   1331 - 1400
HTKEELIELKEEEEIPHSELDLETVQAVQSLTQEESSEHEGAYQDCEETLAACQTLQSYTQADEDPQMSM   1401 - 1470
VEDCHASEHNSPISSVQSHPSQSVRSVSSPNVPALESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSD   1471 - 1540
HSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNSSSQSSCSYGGLSSSSSLTQSSCVVTQQMA   1541 - 1610
SMGSSCSMMQQSSVQPAANCSIKSPQSCVVERPPSNQQQQPPPPPPQQPQPPPPQPQPAPQPPPPQQQPQ   1611 - 1680
QQPQPQPQQPPPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESGSTGNISIYERIPGDFGAGSYSQPSAT   1681 - 1750
FSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLAGTPQAQATMTPPPNLASTT   1751 - 1820
MNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKSAPLPSAAAHQQQLYGRSPSAVAMQAGPRA   1821 - 1890
LAVQRGMNMGVNLMPTPAYNVNSMNMNTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGS   1891 - 1960
QAYTQQPMQPNPHGNMMYTGPSHHSYMNAAGVPKQSLNGPYMRR                             1961 - 2004
//

Text Mined References (52)

PMID Year Title
27133397 2016 Whole exome sequencing reveals de novo pathogenic variants in KAT6A as a cause of a neurodevelopmental disorder.
26667788 2016 FGFR1 and KAT6A rearrangements in patients with hematological malignancies and chromosome 8p11 abnormalities: biological and clinical features.
25922517 2015 MOZ and BMI1 play opposing roles during Hox gene activation in ES cells and in body segment identity specification in vivo.
25728777 2015 Dominant mutations in KAT6A cause intellectual disability with recognizable syndromic features.
25728775 2015 De novo nonsense mutations in KAT6A, a lysine acetyl-transferase gene, cause a syndrome including microcephaly and global developmental delay.
25220592 2014 KAT6A, a chromatin modifier from the 8p11-p12 amplicon is a candidate oncogene in luminal breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24258712 2014 Bromodomain-PHD finger protein 1 is critical for leukemogenesis associated with MOZ-TIF2 fusion.
24150941 2014 The double PHD finger domain of MOZ/MYST3 induces ?-helical structure of the histone H3 tail to facilitate acetylation and methylation sampling and modification.
23994619 2013 Symplekin, a polyadenylation factor, prevents MOZ and MLL activity on HOXA9 in hematopoietic cells.
23431171 2013 MOZ increases p53 acetylation and premature senescence through its complex formation with PML.
23347099 2013 The MYSTerious MOZ, a histone acetyltransferase with a key role in haematopoiesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23063713 2012 Tandem PHD fingers of MORF/MOZ acetyltransferases display selectivity for acetylated histone H3 and are required for the association with chromatin.
23022987 2013 Acute myeloid leukemia with translocation (8;16)(p11;p13) and MYST3-CREBBP rearrangement harbors a distinctive microRNA signature targeting RET proto-oncogene.
22713874 2012 Combinatorial readout of unmodified H3R2 and acetylated H3K14 by the tandem PHD finger of MOZ reveals a regulatory mechanism for HOXA9 transcription.
21880731 2011 Recognition of unmodified histone H3 by the first PHD finger of bromodomain-PHD finger protein 2 provides insights into the regulation of histone acetyltransferases monocytic leukemic zinc-finger protein (MOZ) and MOZ-related factor (MORF).
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20581860 2010 Crosstalk between leukemia-associated proteins MOZ and MLL regulates HOX gene expression in human cord blood CD34+ cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19001415 2009 Monocytic leukemia zinc finger (MOZ) interacts with p53 to induce p21 expression and cell-cycle arrest.
18818702 2009 Genome profiling of acute myelomonocytic leukemia: alteration of the MYB locus in MYST3-linked cases.
18794358 2008 Molecular architecture of quartet MOZ/MORF histone acetyltransferase complexes.
18754862 2008 Roles of the histone acetyltransferase monocytic leukemia zinc finger protein in normal and malignant hematopoiesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18528428 2008 Acute myeloid leukaemia with 8p11 (MYST3) rearrangement: an integrated cytologic, cytogenetic and molecular study by the groupe francophone de cytogénétique hématologique.
17925393 2007 The human monocytic leukemia zinc finger histone acetyltransferase domain contains DNA-binding activity implicated in chromatin targeting.
17805331 2008 NCOA3, a new fusion partner for MOZ/MYST3 in M5 acute myeloid leukemia.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17296583 2007 New types of MYST3-CBP and CBP-MYST3 fusion transcripts in t(8;16)(p11;p13) acute myeloid leukemias.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16613851 2006 MOZ-TIF2 alters cofactor recruitment and histone modification at the RARbeta2 promoter: differential effects of MOZ fusion proteins on CBP- and MOZ-dependent activators.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16387653 2006 ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15657427 2005 MOZ-TIF2 inhibits transcription by nuclear receptors and p53 by impairment of CBP function.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12771199 2003 Transcriptional regulation of the human MIP-1alpha promoter by RUNX1 and MOZ.
12676584 2003 MOZ-TIF2-induced acute myeloid leukemia requires the MOZ nucleosome binding motif and TIF2-mediated recruitment of CBP.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11965546 2002 MOZ and MORF histone acetyltransferases interact with the Runt-domain transcription factor Runx2.
11742995 2001 Activation of AML1-mediated transcription by MOZ and inhibition by the MOZ-CBP fusion protein.
11313971 2001 The monocytic leukemia zinc finger protein MOZ is a histone acetyltransferase.
10824998 2000 MOZ is fused to p300 in an acute monocytic leukemia with t(8;22).
9558366 1998 A novel fusion between MOZ and the nuclear receptor coactivator TIF2 in acute myeloid leukemia.
8849440 1996 A gene map of the human genome.
8782817 1996 The translocation t(8;16)(p11;p13) of acute myeloid leukaemia fuses a putative acetyltransferase to the CREB-binding protein.