Property Summary

NCBI Gene PubMed Count 107
PubMed Score 66.76
PubTator Score 729.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia 2.000 2.2e-02
adrenocortical carcinoma -1.634 7.7e-06
astrocytoma 2.200 6.6e-03
chronic lymphosyte leukemia -1.700 1.7e-07
gastric cancer -1.600 6.5e-03
glioblastoma 2.300 1.6e-03
group 4 medulloblastoma -2.000 2.8e-03
inflammatory breast cancer -1.900 2.2e-03
lung cancer -2.500 4.9e-06
lung carcinoma -1.400 7.2e-06
mucosa-associated lymphoid tissue lympho... 1.440 6.3e-03
Multiple Sclerosis 1.200 1.3e-03
nephrosclerosis -1.232 2.1e-04
non diabetic and post-ischemic heart fai... -1.400 3.0e-03
non-small cell lung cancer -1.448 7.1e-16
ovarian cancer 1.200 2.8e-04
pancreatic cancer -1.400 1.8e-02
pancreatic carcinoma -1.400 1.8e-02
pituitary cancer -3.000 8.1e-08
posterior fossa group B ependymoma -1.200 1.1e-02
primary pancreatic ductal adenocarcinoma 1.782 2.7e-02
psoriasis 1.100 1.5e-02
pterygium -1.400 1.6e-02

 GWAS Trait (1)

Gene RIF (70)

AA Sequence

MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFS      1 - 70
GQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFV     71 - 140
KALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPT    141 - 210
TTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRL    211 - 280
AATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF       281 - 347
//

Text Mined References (118)

PMID Year Title