Property Summary

NCBI Gene PubMed Count 821
PubMed Score 5981.79
PubTator Score 3644.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 2.36335983218913E-12
non-small cell lung cancer 2798 2.70081463434238E-11
malignant mesothelioma 3163 6.14044268018498E-8
lung carcinoma 2844 6.63932249337874E-8
lung cancer 4473 4.55359667712432E-6
inflammatory breast cancer 404 6.51172932283542E-6
acute quadriplegic myopathy 1157 1.54401170929897E-5
hepatocellular carcinoma 550 1.67315236053969E-5
group 4 medulloblastoma 1875 3.3354427899537E-5
Amyotrophic Lateral Sclerosis 432 3.33694929929447E-5
nephrosclerosis 329 1.03023101945647E-4
tuberculosis and treatment for 3 months 327 2.28584217004112E-4
gastric cancer 436 2.62242472253035E-4
pancreatic cancer 2300 3.45807379111853E-4
pancreatic carcinoma 567 3.45807379111855E-4
Rheumatoid Arthritis 1171 3.67682373887125E-4
breast carcinoma 1614 3.67842913732045E-4
ovarian cancer 8492 6.47026139755086E-4
medulloblastoma, large-cell 6234 7.85834510601403E-4
chronic lymphosyte leukemia 232 0.00153186526343911
Waldenstrons macroglobulinemia 765 0.00158766255148685
astrocytoma 1493 0.0028334708986387
colon cancer 1475 0.00300907529330889
glioblastoma 5572 0.00525197338821162
atypical teratoid / rhabdoid tumor 4369 0.0084246664311078
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0121034686725358
pituitary cancer 1972 0.0122355949626145
aldosterone-producing adenoma 664 0.0125836343332441
fibroadenoma 557 0.0240277532882638
pterygium 74 0.0463609239822383
acute myeloid leukemia 785 0.0479132005362848
Disease Target Count Z-score Confidence
Cancer 2346 6.411 3.2

Expression

  Differential Expression (31)

Disease log2 FC p
Rheumatoid Arthritis 3.000 0.000
nephrosclerosis -1.157 0.000
gastric cancer -3.300 0.000
hepatocellular carcinoma -3.100 0.000
pancreatic cancer -2.600 0.000
Waldenstrons macroglobulinemia 1.058 0.002
malignant mesothelioma -2.200 0.000
chronic lymphosyte leukemia -1.100 0.002
astrocytoma 2.100 0.003
glioblastoma 2.000 0.005
atypical teratoid / rhabdoid tumor -1.100 0.008
medulloblastoma, large-cell -1.800 0.001
Amyotrophic Lateral Sclerosis 1.116 0.000
acute quadriplegic myopathy 1.343 0.000
tuberculosis and treatment for 3 months -1.900 0.000
non-small cell lung cancer -1.257 0.000
intraductal papillary-mucinous adenoma (... -1.300 0.012
lung cancer -2.700 0.000
colon cancer -1.600 0.003
breast carcinoma -1.800 0.000
fibroadenoma -1.800 0.024
group 4 medulloblastoma -1.800 0.000
pancreatic carcinoma -2.600 0.000
aldosterone-producing adenoma -1.841 0.013
psoriasis -2.700 0.000
inflammatory breast cancer -2.600 0.000
lung carcinoma -1.200 0.000
pterygium -1.300 0.046
acute myeloid leukemia 2.100 0.048
ovarian cancer 2.500 0.001
pituitary cancer -1.500 0.012

Synonym

Accession P05412 Q6FHM7 Q96G93
Symbols AP1
AP-1
c-Jun

Gene

JUN

PANTHER Protein Class (1)

PDB

1T2K   1A02   1S9K   1FOS   1JNM   1JUN  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (690)

PMID Text
27089238 Findings indicate a role for transcription factor c-Jun as a driver of cancer cell metabolic reprogramming, and suggest that cancers overexpressing JUN may be especially sensitive to glutaminase (GLS)-targeted therapies.
26988982 These results indicate that IL-17A enhances COX2 expression and PGE2 production via the p38/c-Fos and JNK/c-Jun signalling pathways in NP cells to mediate intervertebral disc inflammation.
26858249 Simultaneous high expression of ID1 and c-Jun or c-Fos was correlated with poor survival in esophageal squamous cell carcinoma patients.
26832411 Tead4 cooperates with AP1 transcription factors to coordinate target gene transcription.
26799482 Ap-1 plays an essential role in the regulation of interleukin-6 in the developing enterocyte.
26792858 cistrome for the AP-1 transcription factor c-Jun is comprised of 13,800 binding regions in TNFalpha-stimulated triple-negative breast cancer cells.
26747248 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26719067 the present study indicated that knockdown of NMIIA inhibited the migration and invasion of gastric cancer cells, which may be, at least in part, mediated via the JNK signaling pathway.
26707143 curcumin and ABT-737 on HCC cells was investigated for the first time, to the best of our knowledge. It was found that curcumin markedly enhanced the antitumor effects of ABT-737 on HepG2 cells and activate ROS-ASK1-c-Jun N-terminal kinase pathway .
26631725 A novel AP-1 binding site at -1363 bp of the human TF promoter region was identified.
More...

AA Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK      1 - 70
LASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGA     71 - 140
GMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHH    141 - 210
LPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARL    211 - 280
EEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF                       281 - 331
//

Text Mined References (836)

PMID Year Title
27089238 2016 The oncogenic transcription factor c-Jun regulates glutaminase expression and sensitizes cells to glutaminase-targeted therapy.
26988982 2016 IL-17 mediates inflammatory reactions via p38/c-Fos and JNK/c-Jun activation in an AP-1-dependent manner in human nucleus pulposus cells.
26858249 2016 Inhibitor of Differentiation/DNA Binding 1 (ID1) Inhibits Etoposide-induced Apoptosis in a c-Jun/c-Fos-dependent Manner.
26832411 2016 Tead and AP1 Coordinate Transcription and Motility.
26799482 2016 Differential Expression of the Activator Protein 1 Transcription Factor Regulates Interleukin-1ß Induction of Interleukin 6 in the Developing Enterocyte.
26792858 2016 AP-1 Is a Key Regulator of Proinflammatory Cytokine TNF?-mediated Triple-negative Breast Cancer Progression.
26747248 2016 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26719067 2016 Downregulation of non?muscle myosin IIA expression inhibits migration and invasion of gastric cancer cells via the c?Jun N?terminal kinase signaling pathway.
26707143 2016 Curcumin enhances the antitumor effect of ABT-737 via activation of the ROS-ASK1-JNK pathway in hepatocellular carcinoma cells.
26631725 2016 Purinergic P2Y2 Receptor Control of Tissue Factor Transcription in Human Coronary Artery Endothelial Cells: NEW AP-1 TRANSCRIPTION FACTOR SITE AND NEGATIVE REGULATOR.
More...