Property Summary

NCBI Gene PubMed Count 821
PubMed Score 5981.79
PubTator Score 3644.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cancer 2346 6.411 3.2

Expression

  Differential Expression (31)

Disease log2 FC p
Rheumatoid Arthritis 3.000 3.7e-04
nephrosclerosis -1.157 1.0e-04
gastric cancer -3.300 2.6e-04
hepatocellular carcinoma -3.100 1.7e-05
pancreatic cancer -2.600 3.5e-04
Waldenstrons macroglobulinemia 1.058 1.6e-03
malignant mesothelioma -2.200 6.1e-08
chronic lymphosyte leukemia -1.100 1.5e-03
astrocytoma 2.100 2.8e-03
glioblastoma 2.000 5.3e-03
atypical teratoid / rhabdoid tumor -1.100 8.4e-03
medulloblastoma, large-cell -1.800 7.9e-04
Amyotrophic Lateral Sclerosis 1.116 3.3e-05
acute quadriplegic myopathy 1.343 1.5e-05
tuberculosis and treatment for 3 months -1.900 2.3e-04
non-small cell lung cancer -1.257 2.7e-11
intraductal papillary-mucinous adenoma (... -1.300 1.2e-02
lung cancer -2.700 4.6e-06
colon cancer -1.600 3.0e-03
breast carcinoma -1.800 3.7e-04
fibroadenoma -1.800 2.4e-02
group 4 medulloblastoma -1.800 3.3e-05
pancreatic carcinoma -2.600 3.5e-04
aldosterone-producing adenoma -1.841 1.3e-02
psoriasis -2.700 2.4e-12
inflammatory breast cancer -2.600 6.5e-06
lung carcinoma -1.200 6.6e-08
pterygium -1.300 4.6e-02
acute myeloid leukemia 2.100 4.8e-02
ovarian cancer 2.500 6.5e-04
pituitary cancer -1.500 1.2e-02

Gene RIF (690)

PMID Text
27089238 Findings indicate a role for transcription factor c-Jun as a driver of cancer cell metabolic reprogramming, and suggest that cancers overexpressing JUN may be especially sensitive to glutaminase (GLS)-targeted therapies.
26988982 These results indicate that IL-17A enhances COX2 expression and PGE2 production via the p38/c-Fos and JNK/c-Jun signalling pathways in NP cells to mediate intervertebral disc inflammation.
26858249 Simultaneous high expression of ID1 and c-Jun or c-Fos was correlated with poor survival in esophageal squamous cell carcinoma patients.
26832411 Tead4 cooperates with AP1 transcription factors to coordinate target gene transcription.
26799482 Ap-1 plays an essential role in the regulation of interleukin-6 in the developing enterocyte.
26792858 cistrome for the AP-1 transcription factor c-Jun is comprised of 13,800 binding regions in TNFalpha-stimulated triple-negative breast cancer cells.
26747248 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26719067 the present study indicated that knockdown of NMIIA inhibited the migration and invasion of gastric cancer cells, which may be, at least in part, mediated via the JNK signaling pathway.
26707143 curcumin and ABT-737 on HCC cells was investigated for the first time, to the best of our knowledge. It was found that curcumin markedly enhanced the antitumor effects of ABT-737 on HepG2 cells and activate ROS-ASK1-c-Jun N-terminal kinase pathway .
26631725 A novel AP-1 binding site at -1363 bp of the human TF promoter region was identified.
26581505 The binding and expression of c-Fos/Fra-2 increased as a function of severity of tongue lesions, yet selective participation of c-Jun appears to promote poor differentiation and aggressive tumorigenesis.
26562662 Findings indicate that Interleukin (IL)-1beta-induced interleukin 36 gamma (IL-36gamma) expression is mediated by the activation of transcriptional factors, NF-kappaB p65 and AP-1 (c-jun).
26540629 Palbociclib inhibits epithelial-mesenchymal transition and metastasis in breast cancer via c-Jun/COX-2 signaling pathway.
26530832 A reciprocal antagonism between the MITF and c-Jun interconnects inflammation-induced dedifferentiation with pro-inflammatory cytokine responsiveness of melanoma cells favouring myeloid cell recruitment.
26497679 Tristetraprolin induces cell cycle arrest in breast tumor cells by targeting AP-1/c-Jun and NF-kappaB/RelA pathway.
26493679 The transcription factor AP-1 regulates the activation of AP-1 and TRPM3.
26476743 Altogether, our experiments suggest that histone induces TF expression in ECs via cell surface receptors TLR4 and TLR2, simultaneously depending on the activation of the transcription factors NF-kappaB and AP-1.
26459591 results indicate that AP-1 complexes regulate Robo4 gene expression in endothelial cells
26426522 c-jun expression was found to be significantly higher in the peripheral blood cells of the lungs of COPD patients than healthy controls, suggesting excessive c-jun causes corticosteroid resistance.
26418950 JNK/c-Jun activation and BIM induction is a late pro-apoptotic response of glioma cells treated with alkylating anticancer drugs.
26397987 mitochondrial dysfunction induces EMT through TGF-beta/Smad/Snail signaling via c-Jun/AP-1 activation.
26394174 Data suggest PGE2 induces aromatase and ERB/ESR2 expression by interacting with c-Jun and p38a/MAPK14, thus influencing estradiol production in endometrial stromal cells; inactivation of c-Jun and p38a may be effective in treatment of endometriosis.
26336885 amplification of HMGA2 was associated with the atypical lipomatous tumor/well-differentiated liposarcoma histological type and a good prognosis, whereas CDK4 and JUN amplifications were associated with dedifferentiated liposarcoma histology
26287601 NCOA1 potentiates breast cancer angiogenesis through upregulating HIF1alpha and AP-1-mediated VEGFa expression
26280733 Progesterone acts via GR to drive MKP-1 expression, which in turn inhibits IL-1beta-dependent c-Jun activation and COX-2 expression.
26270987 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
26260845 our data suggest that p65/c-Jun-mediated DNA looping is involved in TNF-alpha-induced MMP-9 up-regulation and that the recruitment of p300 or HDAC1 to NFkappaB and AP-1 binding sites modifies the level of DNA looping.
26136365 SMAP2 immunoprecipitated clathrin and AP-1 through a putative clathrin-binding domain and a CALM-binding domain, and SMAP2 mutants that did not interact with clathrin or AP-1 could not localize to recycling endosomes
26075907 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
26035356 The present study suggests that MAPK15 overexpression may contribute to the malignant transformation of gastric mucosa by prolonging the stability of c-Jun.
26031809 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
26018080 co-expression of c-Fos or Fra1 was able to cooperate with TAp73 in potentiating cellular growth, similarly to c-Jun. These data together suggest that TAp73 plays a vital role in activation of AP-1 target genes via direct binding to c-Jun
25945750 Jra recruits the HP1a/KDM4A complex to its gene body region upon osmotic stress to reduce H3K36 methylation levels and disrupt H3K36 methylation-dependent histone deacetylation
25895972 In all, these data demonstrate that the AP-1 transcription factor is involved in Chlamydia pneumoniae intracellular development.
25865119 Melanoma reprogramming involves thousands of genomic regulatory regions underlying the proliferative and invasive states, identifying SOX10/MITF and AP-1/TEAD as regulators, respectively.
25813203 The expression levels of JunB, JunD and p-c-Jun are positively correlated with tumor cell proliferation in diffuse large B-cell lymphomas
25771902 that STAT1, JAK2, and NFkappaB, together with STAT4, contribute to the development of cell-mediated immunity
25710583 reduced expression in Egyptian patients with hepatocellular carcinoma
25684043 Quinacrine-induced K562 cell apoptosis is mediated through mitochondrial alterations triggered by p38 MAPK-mediated BCL2 down-regulation and suppression of ERK/c-Jun-mediated BCL2L1 expression.
25670814 O-GlcNAcylation of MLL5beta at T440 residue is critical for MLL5 recruitment to the HPV16/18-long control region through its interaction with AP-1.
25656613 Collectively, these findings suggest that REG Ialpha activates c-Jun via the JNK and ERK pathway, thereby enhancing radiosensitivity
25647783 ERK1 and ERK2 regulated the expression of c-Fos and c-Jun proteins in human cervical cancer cells.
25625784 miR-29c exerts its effects on endometrial cell proliferation, apoptosis and invasion by inhibiting the expression of c-Jun.
25600770 Twist1 and AP-1 cooperatively upregulate integrin alpha5 expression to induce invasion and the epithelial-mesenchymal transition.
25571870 c-jun may be involved in the radioresistance of nasopharyngeal carcinoma
25545366 The present study provided the first evidences that miR-1470 mediated lapatinib induced p27 upregulation by targeting c-jun.
25544773 Data indicate that deregulation of transcription factor AP-1 and microRNA-21-mediated axis led to an enhanced cell growth in hepatocellular carcinoma (HCC).
25536346 Reactive oxygen species increased c-Jun, a critical member of transcription factor AP-1 complex, and increased c-Jun binding to the AP-1 site of the CCN1 promoter.
25533033 This study found a correlation between c-Jun expression and lymphoma spread to extranodal sites in diffuse large B-cell lymphoma patients.
25526895 MUC1 mediates autocrine TGF-beta signaling by activating the JNK/AP-1 pathway in hepatocellular carcinoma cells.
25499265 These data strongly suggests a role of aberrant miR-139/Jun negative feedback loop in the development of human gastric cancer.
25483191 Identified a novel binding site for c-Jun in the promoter of the Snail1 gene and report that the activation of the TGFbeta-TRAF6-p38 MAPK pathway promotes both c-Jun expression and its activation via p38alpha-dependent phosphorylation of c-Jun at Ser63.
25477266 The results provide evidence that the regulation of IL-6, IL-10, c-Jun, and STAT3 gene expression in Chronic lymphocytic leukemia B cells is clearly different from normal B lymphocytes.
25476526 These results suggest that XT-1 expression is refractory to the disease process and to inhibition by inflammatory cytokines and that signaling through AP-1, Sp1, and Sp3 is important in the maintenance of XT-1 levels in NP cells.
25463304 The co-introduction of the c-Jun protein resulted in a decrease in the mRNA levels and promoter activity of AKR1B10.
25435485 These results suggest that the localization of ZO-1 in cell-cell contacts is differently regulated by activation and inhibition of JNK and/or p38 MAPK depending on the incubation period.
25428452 CREBH activated by HBx interacted with HBx protein, leading to a synergistic effect on the expression of AP-1 target genes and the proliferation of hepatocellular carcinoma cells and mouse primary hepatocytes.
25422452 c-Jun phosphorylation is a key mediator of macrophage education
25386557 These findings suggest that CH downregulated the expressions of MDR1 mRNA and P-glycoprotein in a time and concentration manner; the mechanism may be mediated via activating c-Jun/JNK pathway
25338512 The authors show that Photorhabdus luminescens PTC5 and PTC3 toxins stimulated gene transcription via myocardin-related transcription factor A (also called MAL) and AP1 in HeLa cells.
25318890 Data suggest that hypoxia-induced autophagy through c-Jun-mediated Beclin1 expression may be a target to reverse the radioresistance in cancer cells.
25281386 RBPMS1 is a critical repressor of AP-1 signaling and RBPMS1 activation may be a useful strategy for cancer treatment.
25271301 Integrated omic analysis of oropharyngeal carcinomas reveals human papillomavirus-dependent regulation of the AP-1 pathway and elevated cortactin protein levels.
25239830 FUT1 mediates c-Jun-induced cell proliferation in ovarian cancer cells.c-Jun transcriptionally modulates FUT1 expression in ovarian cancer cells.
25230788 Human miR-1285-3p could directly repress JUN oncogene expression in hepatocellular carcinoma cells.
25205654 miR200c attenuates P-gp-mediated MDR and metastasis by targeting JNK2/c-Jun signaling pathway in colorectal cancer.
25205054 demonstrated that TGF-beta1 treatment induced the phosphorylation of JNK that was in turn responsible for the increased expression of Jun and Fos
25204501 Taken together, our findings suggest that AEG-1 plays a crucial role in the aggressiveness of osteosarcoma via the JNK/c-Jun/MMP-2 pathway.
25201048 These results demonstrated that S1P-induced COX-2 expression and PGE2 /IL-6 generation was mediated through S1PR1/3/c-Src/PYK2/p42/p44 MAPK- or JNK1/2- and S1PR1/3/c-Src/p38 MAPK-dependent AP-1 activation.
25200491 findings provide the first evidence that FSL-1 induces TLR-2-dependent MMP-9 gene expression which requires the recruitment of MyD88 and leads to activation of MEK1/2 /ERK 1/2, MEK5/ERK5, JNK, p38 MAPK and NF-kappaB/AP-1
25199502 as many as four transcription factors are known to regulate the HMOX1 gene: HSF1, AP-1, NRF2, and NF-kappaB. To investigate induction kinetics of these transcription factors, we constructed mathematical simulation models for each of them
25077945 Endoplasmic reticulum stress activates the hepatic AP-1 complex via MAPK-dependent signaling pathways.
25070240 ISL-1 is tightly linked to non-Hodgkin lymphoma proliferation and development by promoting c-Myc transcription, and its aberrant expression was regulated by p-STAT3/p-c-Jun/ISL-1 complex activation.
25064159 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
25047843 ROS-mediated activation of JAK2 is required for Porphyromonas gingivalis-induced inflammatory cytokine production and the JNK/c-Jun signaling axis is involved in the ROS-dependent regulation of IL-1beta and IL-6 production.
25031700 After diffuse brain injury, brain water content and c-Fos/c-Jun expression change over time
25016017 results support the proposal that cooperative signaling of both NF-kappaB and AP1 (via p38alpha) amplifies STIM1 expression in ECs and, thereby, contributes to the lung vascular hyperpermeability response during sepsis
24931237 NFAT-1, STAT-1 and AP-1 might be the central transcription factors in the pathogenesis of pre-eclampsia.
24914133 Data indicate that hydroxyurea (HU) induces SAR1 protein expression, which in turn activates gamma-globin expression, predominantly through the Gialpha/JNK/Jun pathway.
24913175 Depressed HSV-induced c-Jun N-terminal kinase (JNK) phosphorylation.
24912525 Knockdown of endogenous TAK1 significantly attenuated the ability of Vpr to activate NF-kappaB and AP-1.
24884571 UV-B irradiation attenuated the neuroprotective effects of RF through modulation of the miR-203/c-Jun signaling pathway
24852265 high levels of c-Jun enhance motility in part by driving the expression of ENPP2/Autotaxin
24830720 we found that AP-1 repressed the expression of E-cadherin by transcriptional upregulation of ZEB2 to stimulate cell invasion.
24819052 nTRIP6 both positively and negatively regulates transcription by orchestrating the recruitment of the Mediator complex to AP-1-regulated promoters
24796531 c-Jun is involved in the regulation of differentiation-associated genes in esophageal squamous cell carcinoma
24780373 Data indicate that c-jun activation was critically involved in H5N1 influenza virus replication.
24753227 Resveratrol stimulation upregulates AP-1 transcriptional activity.
24743307 Decreased CSB occupancy of TPA-response elements when c-Jun levels were diminished.
24707477 Abrogate TNF-alpha-activated MAPK/AP-1 signaling.
24679696 Expression of c-Jun and JUN N-terminal kinase (JNK) are significantly reduced in septic patients and correlate inversely with protein phosphatase type 2A expression.
24658403 The results demonstrated that the PI3K/Akt and p38 MAPK pathways, along with the transcription factors NF-kappaB, CEBP, and AP-1, are involved in Nef-induced CCL5 production in astrocytes
24658403 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
24641824 lambda-dCGN induced an inflammatory reaction via both NF-kappaB and AP-1, and enhanced the inflammatory effect of LPS through AP-1 activation
24636898 A complex comprising p300/c-Jun/PARP-1 that bound wild type.
24631457 AP1 activation and SOCS3 induction by EPAC1 in human umbilical vein endothelial cells occur independently of c-Jun phosphorylation on Ser63.
24606718 HA/CD44-induced c-Jun signaling plays a pivotal role in miR-21 production leading to Bcl-2 upregulation and chemoresistance in triple negative breast cancer cells
24587316 TNF-alpha regulates human eosinophil apoptosis via ligation of TNF-receptor 1 and balance between NF-kappaB and AP-1.
24574500 Data show that tumor necrosis factor (TNF) tolerance in monocytic cells differentially inhibits NF-kappaB/transcription factor AP-1 and protein phosphatase 1 (PP1)-associated signaling.
24566851 c-Jun transactivates Puma gene expression to promote osteoarthritis.
24559171 PAGE4, a regulator of c-Jun transactivation, is phosphorylated by homeodomain-interacting protein kinase 1.
24551192 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
24526449 Upregulation of c-Jun is a marker for predemyelinating axonal perturbation.
24500404 contribution from c-Jun, c-Fos, and AP-1 effectors of mitogen-associated kinase signaling, in endometriosis, is reported.
24481121 These results indicate that sLZIP plays a role in expression of c-Jun, and migration and invasion of cervical cancer cells via regulation of MMP-9 transcription.
24447950 Thus, c-Jun can exert a positive or negative effect via the AP-1 binding site in the HIV-1 long-terminal repeat promoter, depending on the presence or absence of Tat.
24447950 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
24439903 Chlamydia trachomatis replication depends on a subset of altered proteins, such as Pin1 and Men1, that regulate the host transcription factor AP-1 controlling host inflammation, stress, and cell survival.
24369359 This is the first report of MCL1 and JUN coamplification in pseudomyxoma peritonei.
24366551 PRKCA activity suppresses the level of ER-alpha expression by inhibiting c-JUN phosphorylation.
24366538 Southwestern blot assay, EMSA and ChIP assays indicate that only one of five isoforms of GLI1 may be responsible for the Hedgehog link with C-JUN and thus, increased platinum-DNA adduct repair
24335313 Sirtuin 1 regulates hepatitis B virus transcription and replication by targeting transcription factor AP-1.
24291398 with the reported role of c-Jun in vascular dysfunctions triggered by our findings shed new light on the molecular mechanisms underlying KRIT1 function and CCM pathogenesis
24265756 The -615 to -624 bp region is the key binding site of AP-1 in ETB receptor promoter and was found to be crucial for inducible ETB receptor expression.
24263171 Data suggest that disrupting prostate-associated gene 4 (PAGE4)/c-Jun interaction using small molecules could be a novel strategy to treat prostate cancer.
24244375 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
24225433 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
24190040 Stress-inducible truncated SRSF3 may participate in the acceleration of cell growth through facilitating c-Jun-mediated G1 progression under stressful conditions.
24187576 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
24162774 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
24113186 Multiphosphorylation of c-Jun functions as a sensitivity amplifier of the JNK cascade, setting the threshold for c-Jun pro-apoptotic activity in neuronal cells.
24100343 M-CSF induces macrophage transformation by upregulating c-Jun with a certain synergy of NFkappaB.
24091941 Human TTC5, a novel tetratricopeptide repeat domain containing gene, activates p53 and inhibits AP-1 pathway.
24073601 This study indicates that increased expression of c-Fos, p-c-Jun, members of AP-1 transcriptional factor and p-JNK is associated with neuronal degeneration in the ganglion cell layer of retinas in diabetic patients.
24038602 Binding of specific AP-1 factors, we found JunD associated with the LILRB1 distal promoter.
24038215 These results suggest that the MKK4/JNK/c-jun signaling pathway mediates TNF alpha-dependent inhibition of apo A-I synthesis
24027432 c-Jun is negatively regulated through the coordinated action of COP1 and GSK3beta.
24004834 H. pylori-triggered CACUL1 production occurred in an activating protein 1-dependent manner and regulated matrix metalloproteinase 9 and Slug expression to affect the invasion and metastasis of tumor cells.
23942796 Jun proteins (pc-Jun and JunD) influence carcinogenesis and tumour progression, suggesting a significant role as prognostic predictors in human ovarian carcinoma.
23929433 AP-1 and NFAT4 complex promotes miR-23a expression.
23922701 Dysregulation of pol iota by JNK/c-Jun is involved in carcinogenesis and offer a novel understanding of the role of pol iota or c-Jun in mutagenesis.
23906792 CTGF acting through Rac1 activates the MLK3/JNK signaling pathway, which in turn initiates AP-1 activation and recruitment of c-Jun and c-Fos to the collagen I promoter and ultimately induces collagen I expression in human lung fibroblasts
23844083 Protein kinase R modulates c-Fos and c-Jun signaling to promote proliferation of hepatocellular carcinoma with hepatitis C virus infection.
23835612 The above studies demonstrate that EGCG may exert at least part of its anti-invasive effect in ECV304 human endothelial cells by controlling MMP-9 expression through the suppression of ROS, NF-kappaB and AP-1
23832539 Data show that AP1 is the transcriptional factor that contributes to peroxisome proliferator-activated receptor delta gene (PPARdelta) expression in LoVo cells.
23818969 Results show elevated PAK3 expression at both the mRNA and protein level in cJun/AP-1-over-expressing Rat1a fibroblasts, as well as in transformed human fibroblasts.
23814048 The recruitment of GR to ERalpha-binding regions (EBRs) requires assistance from ERalpha and FOXA1 and is facilitated by AP1 binding within the EBRs.
23770289 p21WAF1-specific small interfering RNA inhibited IL-5-induced cell migration, ERK activity, MMP-9 expression, and activation of NF-kappaB and AP-1 in bladder cancer cells.
23762330 This is the first report elucidating a feedback regulation between miR-127 and the TGFbeta/c-Jun cascade in hepatocellular carcinoma migration via MMP13.
23762317 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
23752183 PTHrP was found to inhibit DKK1 expression through c-Jun-mediated inhibition of beta-catenin activity on the DKK1 promoter.
23749999 Data indicate that the C-terminal JunB caspase cleavage product functions as a potent inhibitor of AP-1-dependent transcription.
23747343 Activator protein-1 has a role in multidrug resistance associated protein 3 upregulation by 17alpha-ethynylestradiol.
23720779 Data indicate that XIAP E3 ligase mediates cyclin D1 transcription via PP2A-regulated c-Jun/AP-1 activation.
23690655 Data found that p38/AP-1 could be the major inhibitory pathway in the NGACP-mediated anti-inflammatory response.
23686163 This effect( antiproliferative GSI-I/TRAIL synergism ) seemed to be related to the activation of the transcription factor AP1 that was a consequence of Notch inhibition, as demonstrated by Notch-1 silencing experiments.
23682787 Phyllanthus emblica extract downregulates expression of AP-1 protein components in human cervical cancer cells.
23671702 Data show that curcumin-loaded polyvinylpyrrolidone nanoparticles (CURN) decreased the expression of ICAM-1, inhibited NADPH oxidase (NOX)-derived ROS generation, and reduced MAPKs and AP-1 transcription factor binding activities.
23669365 RHBDD1 could inhibit cell apoptosis by activating and upregulating c-Jun and its downstream target, Bcl-3
23665993 Data indicate that the menstrual cyclic expression of bcl-2 could be controlled by either direct binding of estrogen receptor alpha (ERalpha) to estrogen-responsive element (ERE) in the c-Jun promoter or the interaction of ERalpha with c-Jun.
23665382 Data suggest a model in which IL-2 transcriptional synergy is mediated by the unique recruitment of a cJun homodimer to the -45 NFAT site by NFATc2, where it acts as a co-activator for IL-2 transcription.
23625206 Data indicate that estrogen induced the expression of c-Jun, Fra-1, c-Fos, cyclin D1 and cyclin E1 while tamoxifen (TMX) decreased the expression.
23625009 gain-of-function mutant cellular c-Jun and c-Fos proteins preferentially bind methylated DNA, which disrupts Epstein-Barr virus latency
23624934 Arginine methylation of RACO-1 is required for efficient transcriptional activation by c-Jun/AP-1 and thus identify PRMT1 as an important regulator of c-Jun/AP-1 function.
23615400 Small interfering RNA knockdown of c-Jun abrogated pardaxin-induced caspase activation and cell death.
23614275 Report c-Jun expression in skin keratinocytes/fibroblasts and keloid fibroblasts exposed to genistein.
23608488 IL-4 suppression of IL-1-induced MMP-3 expression is mediated at least in part by inhibition of AP-1 binding to the MMP-3 promoter.
23583295 these findings strongly suggest that the increased binding of transcription factors to NF-kappaB and AP-1 elements in the CCL2 promoter is responsible for the active transcription expression of CCL2 in pulmonary fibrosis.
23580428 We have provided evidence that hepatitis C virus core+1/ARFP represses hepcidin promoter activity through the AP1 binding site, reducing hepcidin mRNA and protein levels.
23578467 C-myc, c-jun and c-fos expression values also showed a time-dependent increase in surviving patients.
23562910 FMR2 is an upstream regulator of FOS and JUN, and further link deregulation of the immediate early response genes to the pathology of ID- and FRAXE-associated ID in particular.
23546882 Activator protein-1 regulates the transcription of miR-144 and the up-regulation of miR-144 at least partially induces the suppression of the ADAM10.
23523566 The inhibition of androgen receptor by c-Jun occurs in both hormone naive and castration-resistant prostate cancer cells.
23467542 Both NF-kappaB and c-Jun/AP-1 can be activated and play important roles in the process of anti-beta2GPI/beta2GPI-induced tissue factor expression in monocytes.
23455325 Mutations of NF-kappaB and AP1-binding sites abolished or decreased IKK-induced interleukin-8 (IL-8) promoter activity.
23454483 Ethanol increases Pol III transcription through a response element which is composed of the overlapping Elk1 and AP-1 binding sites of the TBP promoter. The binding sites may play a role in ethanol-induced deregulation of Pol III genes in liver tumors.
23437118 HCV-induced transcription factors AP-1, Sp1, NF-kappaB and STAT-3 are involved in TGF-beta1 gene expression.
23404530 these results suggest that pioglitazone inhibits HG-induced ECM accumulation in RPMCs by increasing PPARgamma expression, and by inhibiting the NF-kappaB and AP-1 pathways.
23404426 these results indicate that the TAM-stimulated antiproliferation of MCF-7 cells is positively regulated by c-Jun through activation of the PKC pathway.
23396363 Sumoylation of the c-fos-c-jun complex could serve to buffer transcriptional activation of AP-1 target genes.
23362975 We have demonstrated increased expression of c-Jun and Sox-2 in schwannoma compared to traumatic neuroma.
23339184 we show that the suppression was mediated, at least in part, by a suspension culture-driven decrease in the levels of two members of the AP1 transcription factor complex, c-Jun and Fra2
23331079 Il-1beta enhances cell migration through AP-1 and NF-kappaB pathway-dependent FGF2 expression in human corneal endothelial cells.
23300800 Short chain fatty acids, especially butyrate, regulate the AP-1 signaling pathway, a feature that may contribute to the physiological impact of the gut microbiota on the host.
23269699 Results indicate that both increased cJUN and the cis-acting ATF/CRE sequence within the ATF3 promoter contribute to the transcriptional activation of the gene during the amino acid response (AAR).
23236059 Authors have found the primary ability of HIV-1 to establish latent infection in this system to be controlled by a four-nucleotide (nt) AP-1 element just upstream of the NF-kappaB element in the viral promoter.
23226410 Trans-acting factor binding sites and nuclear factors AP-1 and NFkappaB that are involved in the regulation of cell-specific CD44 expression, are reported.
23223231 AP-1 and Sp3 are key regulators of IL-1beta-mediated modulation of xylosyltransferase I expression.
23182717 Data show that a photodynamic therapy (PDT) dose-dependent upregulation of CRP gene, as well as of PTX3 and ficolin 1 genes in lung tumor A549 cells, and indicate critical role played by PI3K/Akt/AP-1 pathway.
23163821 These findings suggest that C. pneumoniae initiates signalling via TLR3 and MAPK that activate AP-1, a known immune activator in other bacteria not previously shown for chlamydiae, triggering inflammation linked to C. pneumoniae disease
23153494 Unexpectedly, we found Bcl10 in a complex with the clathrin adaptors AP1 and EpsinR.
23135283 PAX2 protein induces expression of cyclin D1 through activating AP-1 protein and promotes proliferation of colon cancer cells.
23047699 found that human serum affects viral transcription in a dose-dependent manner by activating the activator protein-1 (AP-1) member proteins c-FOS, JunD, and JunB in TZM-bl cells
23041974 Liver cancer initiation is controlled by AP-1 through SIRT6-dependent inhibition of survivin.
23028371 CSB-PGBD3 protein modulates a preexisting AP-1-based regulatory network reshaping the transcriptome in Cockayne syndrome patients
23027969 Aberrant expression of c-Jun in glioblastoma by internal ribosome entry site (IRES)-mediated translational activation.
22988241 AP-1 activation in promoting LY6K gene expression that regulates cell mobility of breast cancer cells
22981541 AP-1 is founded to be a potential transcriptional activator of SPATA12. The promoter activity of SPATA12 was drastically declined after AP-1 binding site mutation or deletion.
22974165 The overexpression of c-Jun, p73 and Casp-9 in thymic epithelial tumors is closely related with the pathogenesis and biological behavior of the neoplasms.
22966201 The c-Jun N-terminal kinase (JNK) is targeted to processing bodies in response to oxidative stress and promotes the phosphorylation of 4E-T.
22933572 These results identify AATF as a nucleolar-confined c-Jun cofactor whose expression levels and spatial distribution determine the stress-induced activity of c-Jun and the levels of c-Jun-mediated apoptosis.
22926518 specific members of the AP-1 transcription factor family determine TGFbeta signaling specificity in breast cancer cell invasion
22911824 Fra-1 mediates anti-fibrotic effects in the lung through the modulation of proinflammatory, profibrotic and fibrotic gene expression.
22879913 The repression of MMP-9 transcription in response to IFNbeta occurs by the recruitment of HDAC1 via the proximal AP-1 binding site.
22869147 study found that activator protein 1 (AP-1), Ets related gene (Erg) and glucocorticoid receptor pathways were differentially regulated in sensitive and resistant acute lymphoblastic leukemia.
22860098 Upstream of c-Jun, it was revealed that c-Jun NH2-terminal kinases (JNK) is essential for controlling PES1 expression
22853846 CpG-ODN promoted nuclear translocation and activation of AP-1.
22843696 ATF2-Jun heterodimers bind IFNb in both orientations alone and in association with IRF3 and HMGI
22801218 Pdcd4 knockdown up-regulates MAP kinase kinase kinase kinase 1 (MAP4K1) expression and increases phosphorylation of c-Jun.
22797068 c-Jun is a main mediator of the effects of miR-125b on melanoma cells
22791811 identify a novel ERalpha/AP-1 target, PKIB (cAMP-dependent protein kinase inhibitor-beta), which is overexpressed in ERalpha-positive breast cancer tissues
22771387 TGF-beta1-induced tissue factor expression required the recruitment of c-Fos and JunD into a heterodimeric activator protein-1 complex.
22749179 Cultivated ginseng inhibits UVB-induced collagenolytic MMP production by interfering with MAPK/AP-1 and NF-kappaB signaling.
22688014 Data show that IL-23 p19 production following IL-1beta stimulation was depended on concurrent NF-kappaB signaling and MAPKs/AP-1 pathways.
22685373 Mutation of the AP-1 site reduced both basal and IL1B-stimulated expression but to a lesser extent.
22675553 The interaction between HGF and c-Met increases OPN expression in human osteoblasts via the PI3K, Akt, c-Src, c-Jun, and AP-1 signaling pathway.
22597534 Dihydrotestosterone inhibits lectin-like oxidized-LDL receptor-1 expression in aortic endothelial cells via a NF-kappaB/AP-1-mediated mechanism
22570239 Polycystin-1 regulates amphiregulin expression through CREB and AP1 signalling, which has implications in ADPKD cell proliferation
22512945 COS had inhibitory effect (P<0.01) on TNF-alpha induced NF-kappaB binding activity while stimulatory effect (P<0.001) on AP-1 binding activity.
22508041 MiR-155 down-regulates the expression of c-Jun protein in ultraviolet A-exposed human dermal fibroblasts.
22484283 The results suggest that MIC-1 secreted from cancer cells stimulates endothelial cell proliferation by enhancing AP-1- and E2F-dependent expression of G(1) cyclins via PI3K/Akt, JNK, and ERK signaling pathways.
22450687 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
22438909 Blimp1 is a mediator of Ras/Raf/AP-1 signaling that promotes cell migration, and is repressed by LOX-PP in lung cancer.
22429882 findings suggest a novel role for the steady state intracellular ROS concentration, where the compartmentalized, different systems involved in the intracellular ROS production, could be essential for the expression of AP1-dependent genes, as TGF-beta1
22417306 RNAi to diminish expression of ErbB receptors and AP-1 proteins strongly suggested that STAT3 established a balance that maintains the appropriate set of AP-1 proteins and participates in a complex network for regulating keratinocyte differentiation.
22399296 phosphorylation at Ser-118 is required for ER to bind both p38gamma and c-Jun, thereby promoting ER relocation from ERE to AP-1 promoter sites.
22394497 PDPN expression in human glioblastoma multiforme is caused by loss of PTEN function and activation of the PI3K-AKT-AP-1 signaling pathway, accompanied by epigenetic regulation of PDPN promoter activity
22384232 Syk plays a key role in TLR4-mediated macrophage responses to host-generated ligands, like mmLDL, with subsequent activation of an AP-1 transcription program
22384197 JunD/AP-1-mediated gene expression promotes lymphocyte growth dependent on interleukin-7 signal transduction
22354960 c-Jun in cooperation with Ets2 increases the expression of Syk and contributes to Syk-mediated heightened calcium responses in systemic lupus erythematosus T cells.
22331067 in human primary CD4+ T cells, IKKbeta is required for the activation of NF-kappaB and AP-1 transcription factors in response to engagement of CD3 and CD28 coreceptor
22328508 Dysfunction of the AP1-dependent clathrin coating at the TGN but not at the plasma membrane prevented autophagosome formation.
22307329 DYRK2 regulates tumor progression through modulation of c-Jun and c-Myc
22271878 AP-1 signaling and EBV infection represent alternative mechanisms of PD-L1 induction
22271085 The functional role of Notch in human papillomaviridae-mediated transformation is dosage dependent and correlated to a change in AP-1.
22266871 inhibition of Gli1 by a specific shRNA inhibits the upregulation of c-jun Ser63/73, and also inhibits the upregulation of three genes essential to NER (ERCC1, XPD) and base excision repair (XRCC1).
22265050 results demonstrate that the c-Jun/activator protein 1 pathway is critical for maintaining lung alveolar cell homeostasis and that loss of its expression can contribute to lung inflammation and progressive emphysema.
22239235 NS1 proteins of avian influenza A viruses (H6N8 and H4N6) have an ability to inhibit dsRNA-induced AP-1 transcription factor in human A549.
22235337 IL-11 mediated differential activation of signaling and expression of effector molecules
22189957 Genetic variants of c-Jun and their interaction with smoking and drinking increase the susceptibility to lung cancer.
22176144 c-Jun is rarely expressed in normal nerves, but it is expressed in Schwann cell nuclei of pathological nerves
22139817 AP-1 is up-regulated in a TGF-beta-dependent manner in systemic sclerosis.
22132731 EpCAM expression can influence the JNK/AP-1 signal transduction pathway, and suggest that modulation of AP-1 transcription factor activity contributes to EpCAM-dependent breast cancer invasion.
22119392 BMP-2 can inhibit LPS-induced TF protein expression and surface presentation in human MNCs by downregulation of Erk1/2, p38, and JNK signaling.
22092038 A gradual increase of AP-1 activation was found in non-progressive and progressive phases of atherosclerosis.
22083952 FOXK2 can promote transcriptional activation and is required for the efficient recruitment of AP-1 components to chromatin.
22077140 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
22051934 These results suggest that the Nrf2/ARE/Jun/Akt/Erk pathway plays an important role in the regulation of icariside-mediated antioxidant effects in HepG2 cells.
22002117 down-regulation of the Twist gene suppressed the proliferation of MKN45 gastric cancer cells by negatively regulating the AP-1 activity
22001392 The PTPROt promoter is responsive to over- and underexpression of AP-1, confirming the role of AP-1 in PTPROt expression.
21989944 low molecular weight hyaluronan produced by lung fibroblasts in response to cyclic stretch increases the secretion of IL-8 in transformed bronchial epithelial cells via AP-1 and NF-kappaB signalling pathways.
21972703 The increased levels of ICAM-1 and C-Jun are negative prognostic factors for the patients with non-small cell lung cancer.
21937452 the diversity and importance of non-canonical binding site recognition by various AP-1 family proteins
21895606 Both AP-1 and NF-kappaB were essential for SS-activated transcription, with the cells responding to NF-kappaB activation within minutes
21872498 These observations suggest that c-Jun is involved in APF-mediated inhibition for bladder tumor cell growth
21862593 AP-1 sequences within the c-JUN gene can function as transcriptional amino acid-response elements.
21835891 These results demonstrate a novel pathway of estrogen regulation of gene expression by cooperation between ER and AP-1 at the distal enhancer element and that AP-1 is involved in estrogen induction of the c-myc oncogene.
21835421 These results demonstrated the role of TAK1 as an important upstream signaling molecule regulating RSV-induced NF-kappaB and AP-1 activation.
21822357 Data show that HPV16E6-dependent c-fos oncogenic protein expression contributes to AP-1 complex formation under oxidative stress in SiHa cells.
21814482 Dimerumic acid inhibits AP-1-mediated MMP-7 gene transcription in H2O2-stimulated SW620 cells.
21801875 Podoplanin is regulated by AP-1 and promotes platelet aggregation and cell migration in osteosarcoma
21799768 the prolonged IL-4 expression in NFAT1 deficient Th2 cells is mediated by preferential binding of JUNB/SATB1 to the IL-4 promoter with permissive chromatin architecture
21745629 The attenuation of palmitate-induced MIP-1 and IL-8 gene expressions by capsaicin is associated with reduced activation of c-Jun N-terminal kinase, c-Jun, and p38 and preserved beta-oxidation activity.
21743958 The results suggest that Egr-1 may promote prostate cancer development by modulating the activity of factors NF-kappaB and AP-1, which are involved in cell proliferation and apoptosis.
21739277 Transient expression of GADD45alpha and AP-1 family transcription factors is sufficient to induce apoptosis in acute myeloid leukemia.
21732343 In a signaling cascade, the loss of E-cadherin activates the transcriptional regulator ETS-1 and consequently leads to the induction of RhoC expression that stabilizes c-Jun in melanoma.
21703547 identification of c-Jun binding sites and potential target genes in the genome scale may improve our fundamental understanding in the molecular mechanisms underlying the transcription regulation related to c-Jun
21699750 Results suggest that HS1BP3 regulates apoptosis via HS1 and stimulates AP-1-mediated transcription.
21697091 Truncation, randomization, and selection: generation of a reduced length c-Jun antagonist that retains high interaction stability.
21685329 An increase in venous filling pressure and thus wall tension is sufficient to activate AP-1, which, in turn, triggers varicose remodeling through fuelling MMP-2 activity and smooth muscle cell hyperplasia in the venous vessel wall.
21647439 AP-1, CREB and NFkappaB form an integrated transcriptional network that is largely responsible for maintaining repression of target genes downstream of GSK-3 signaling
21640141 Two AP-1 components, c-Jun and Fra-1, were phosphorylated, and bound to the AP-1 binding site of the MMP-1 promoter in 143B cells.
21617851 overexpression of EGR-1 selectively increased AP-1 and NF-kappaB activation, and that the activation of these nuclear factors appears to be essential for the induction of proliferation and anchorage independence in activated PC-3 and LNCaP cells
21617575 Activation of PPARgamma by troglitazone is effective for HMGB1 inhibition via suppressing NF-kappaB and AP-1 transcriptional activity in endothelial cells.
21607373 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
21570970 c-Jun/AP-1 activity mediated by JNK, PI3K/Akt and ERK pathways is required for laminin-1-induced neurite outgrowth in human bone marrow mesenchymal stem cells.
21559334 CDK4-mediated regulation of cell functions via c-Jun phosphorylation and AP-1 activation
21530485 c-Jun/AP-1 signaling may, in part, regulate serum-induced nCDase gene transcription
21526160 Mutations of the intragenic AP-1 sites individually or in combination altered HIV-1 replication.
21518489 Tetrandrine can inhibit the expression of YB-1 and up-regulate the expression of c-Jun, which inhibits the expression of MDR1 gene in K562 cells.
21511059 kob A inhibited SNP-induced phosphorylation of JNK and c-Jun, and SNP-induced reduction in NF-kappaBeta and AP-1 activities.
21496208 an intricate network of energetically-coupled residues within the basic regions of the Jun-Fos heterodimeric transcription factor accounts for its allosteric binding to DNA
21454713 the human apolipoprotein M gene is regulated in opposite ways by hepatocyte nuclear factor 1 and Jun transcription factors
21451046 Traumatic axonal injury in transgenic mice induces an early and sustained activation of c-Jun and ATF-3 (activating transcription factor 3), known regulators of axon regeneration.
21439937 Nuclear accumulation of c-Jun does not require its functions as a transcription factor or the interaction with its kinase JNK.
21417953 The results suggest a role for AP-1 in the proliferation, G(2)/M progression and inhibition of p21 expression in cervical cancer.
21410405 Finding supports the notion that the combination of inappropriate STAT3 and AP-1 activities drives elevated MMP-1 expression and tissue invasion in colorectal cancer.
21397653 Chlorella-derived peptide inhibits UVB-induced MMP-1 expression in skin fibroblasts by suppressing expression of AP-1 and CYR61 and MCP-1 production.
21393476 suggests that -673C > T and -1318T > G genetic variants in c-Jun promoter regions contribute to an increased risk of colorectal cancer, possibly by elevating the transcription activity and protein expression levels that appeared to upregulate c-Jun
21381700 Formation of intramolecular purine motif triplex containing a polypurine-polypyrimidine segment of c-jun protooncogene takes place in the presence of sodium; addition of magnesium cations is not mandatory but bestows thermal stability to the triplex.
21364631 The results provide evidence that the JNK/c-Jun/AP-1 pathway plays a key role for T-cell death regulation in response to gal-1 stimulation.
21360282 Reporter gene analysis showed that DUSP13B had significant inhibitory effect on AP-1-dependent gene expression, but DUSP13A did not
21350237 report a novel transcriptional cooperation between GATA factors and cJUN on the mouse Star and human STAR promoters in MA-10 Leydig cells. This cooperation was observed with different GATA members, whereas only cJUN could cooperate with GATA factors
21349840 Liver X receptor-retinoid X receptor (LXR-RXR) heterodimer cistrome reveals coordination of LXR and AP1 signaling in keratinocytes
21338584 In alcohol-dependent subjects a low risk single nucleotide polymorphism resides within the noncanonical AP-1 binding element.
21289643 JunB and c-Jun have opposite roles in human epidermal neoplasia and that their functional specificities are dependent on both N- and C-terminal domains.
21268080 Cigarette smoke extract regulates cytosolic phospholipase A2 expression via NADPH oxidase/MAPKs/AP-1 and p300 in human tracheal smooth muscle cells.
21212516 These results suggest that silibinin might induce p53-mediated autophagic cell death by activating ROS-p38 and JNK pathways, as well as inhibiting MEK/ERK and PI3K/Akt pathways.
21148792 These data suggest a novel important biological role for NF-kappaB pathway in TNF-alpha-induced TSLP expression in human airway smooth muscle cells.
21145111 Human periodontal ligament fibroblasts are a target of Th17, and that IL-17 appears to up-regulate the expression of IL-23 p19 via a homeostatic mechanism involving Akt-, p38 MAPK-, and ERK 1/2-dependent NF-kappaB signalling versus the JNK/AP-1 pathway.
21134350 results indicate involvement of the JNK/c-jun pathway in AR-mediated upregulation of CYP27A1. The link to JNK signaling is interesting since inflammatory processes may upregulate CYP27A1 to clear cholesterol from peripheral tissues.
21106746 results demonstrating dispensability of enhancer AP-1 binding motifs in infectious life cycle of cytomegalovirus and its compensation through NF-kappaB elements evidence functional robustness of major immediate-early enhancer regulation by host factors
21106530 Alcohol induces RNA polymerase III-dependent transcription through c-Jun by co-regulating TATA-binding protein (TBP) and Brf1 expression.
21081472 results suggest that MSP induces uPAR expression via MAPK, AP-1 and NF-kappaB signaling pathways
21081043 The expression of COX-2 was significantly associated with the expressions of transcription factors NFAT3 and c-Fos in nonsmall cell lung cancer.
21034562 Intracellular CMTM2 can negatively regulate HIV-1 transcription, at least in part, by targeting the AP-1 and CREB pathways.
21034562 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
21030269 AP-1 mediates Ang II-induced MIF expression which contributes to atherosclerotic plaque destabilization in human endothelial cells.
20977688 These data provide novel insights into the tumor-suppressor function of E-cadherin, which contributes to the suppression of c-Jun protein translation and transcriptional activity.
20976196 A novel role of the surface protease GP63 in the Leishmania-mediated subversion of host AP-1 activity.
20955203 TNF receptor I on keratinocytes is a binding partner for staphylococcal protein A resulting in the activation of p65 NF kappa B, AP-1, and downstream gene transcription.
20952681 ET-1-mediated MIP-1beta gene expression is regulated via hypoxia-response elements, AP-1, and NF-kappaB cis-binding elements in its promoter and negatively regulated by microRNA-195, which targets the 3' untranslated region of MIP-1beta RNA
20943203 Data show that 17beta-estradiol/ERalpha regulates human WNK4 expression partly through AP-1 binding to the WNK4 promoter.
20942798 phorbol ester PMA increases TBX3 protein and mRNA levels in a protein kinase C-dependent manner via the AP-1 transcription factors c-Jun and JunB
20939893 STAT3 and c-Jun could physically interact and bind to the AP-1 site, implicating that the interplay of both transcriptional factors on the AP-1 site is responsible for isoproterenol-stimulated MMP-7 expression in gastric cancer cells.
20837772 These findings reveal a novel function of Fra-2/AP-1 as a positive regulator of bone and matrix formation in mice and humans.
20698984 Pseudomonas fluorescens exerts a cytotoxic effect on epithelial intestinal cells and induces Interleukin-8 via the AP-1 signaling.
20688351 These findings suggest that c-Jun plays a key role in pathological events and may represent a novel therapeutic target in acute renal allograft rejection.
20683948 HCV core protein potentiates chemically induced HCC through c-Jun activation, which in turn, enhances cell proliferation, suppresses apoptosis, and impairs oxidative DNA damage repair, leading to hepatocellular transformation
20680410 show that STS-26T clones conditionally expressing oncogenic N-Ras show increased phosphorylated ERK1,2 and phosphorylated JNK expression concomitant with increased AP-1 activity
20665665 AP-1 and NF-kappaB play an essential role in the hydrogen peroxide-induced beta(2)-GPI expression.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20619956 calorimetric studies of atf-2 and c-jun transcription factors
20607803 Suggest that c-jun is a positive regulator of TAp63 promoter activity and protein expression and that TAp63 probably plays a growth suppressor role in the Hep3B human hepatocellular carcinoma.
20590529 MEF2A and MEF2D play dual roles in human macrophages differentiation, as activators and as repressors of c-jun transcription.
20557936 A region of NFATc2 C-terminal of the DNA binding domain was necessary and sufficient for interaction with cJun in the absence of DNA, and this same region of NFATc2 was required for the synergistic activation of IL-2 transcription in T cells.
20554528 the differential up-regulation of MKP3 by Ets2 and of DUSP5 by c-Jun may converge in similar functional roles for these MAP kinase phosphatases in the growth arrest versus proliferation decisions of breast cancer cells
20543003 AP-1 and glucocorticoid receptor interaction increased after dexamethasone stimulation in asthmatic fibroblasts. AP-1 overexpression in control fibroblasts abrogated collagen gene response to Dex.
20531301 Inhibition of AP-1 by SARI negatively regulates transformation progression mediated by CCN1.
20519498 Transcription of the transforming growth factor beta activating integrin beta8 subunit is regulated by SP3, AP-1, and the p38 pathway
20511396 results demonstrate that in situ PLA is a powerful diagnostic tool to analyze and quantify the amounts of biologically critical AP-1 dimers in fixed cells and tissue material
20510020 Results suggest that SAMD4B is a widely expressed gene involved in AP-1-, p53-and p21-mediated transcriptional signaling activity.
20508969 These results reveal a novel mechanism by which ARNT acts as a modulator to bridge the c-Jun/Sp1 interaction and plays a role in EGF-mediated gene expression under normoxic conditions.
20507572 The aim of this study was to investigate the role of the transcription factors, AP-1 and NF-kappaB, in IL-6 and CXCL8 regulation in Jurkat T-cells.
20505831 The presented data, which was obtained in the test-tube experiments, adds GCN4 and c-Jun to the pool of proteins with multiple functions.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20483790 functionally unopposed, network-dependent microglial MMP-1/-3 gene expression and secretion regulated by NF-kappaB and AP-1 subunits were demonstrated in vitro and, for the first time, in CNS tuberculosis patients
20482821 BEX2 has a functional interplay with c-Jun and p65/RelA in breast cancer.
20479762 The adults, low early-life socioeconomic status individuals who experienced high maternal warmth would show reduced activity of IL-6.
20459032 Acrylamide can induce high protein expressions of c-fos and c-jun proto-oncogenes and apoptosis in L-02 cells.
20448330 essential for the expression of a glioblastoma multiforme related IL-13Ra2 transcript
20432452 These results suggest that in human rheumatoid arthritis synovial fibroblasts, activation of ERK, JNK, AP-1, and NF-kappaB are essential for IL-1beta-induced ICAM-1 expression and leukocyte adhesion.
20430872 Collectively, these data suggest that CHOP and AP-1(c-Jun) cooperatively mediate PUMA induction during hepatocyte lipoapoptosis.
20395206 Extracellular signal-regulated kinase 8-mediated c-Jun phosphorylation increases tumorigenesis of human colon cancer
20371606 FGF2 induction of NOS3 expression is mainly mediated by AP-1-dependent transcription involving JunB and Fra1 up-regulation via sustained ERK2/1 activation in endothelial cells
20353996 We show evidence for the first time of an interdependence of TAF4b and AP-1 family members in cell type-specific promoter recognition and initiation of transcription in the context of cancer progression and EMT.
20353950 AP-1 (Fra-1/c-Jun)-mediated induction of expression of matrix metalloproteinase-2 is required for 15S-hydroxyeicosatetraenoic acid-induced angiogenesis
20333648 EV71-induced COX-2 expression associated with prostaglandin E(2) production is mediated through activation of c-Src/PDGFR/PI3K/Akt/p42/p44 MAPK to initiate the expression of AP-1.
20331980 Over-expression of TMME174 enhanced the transcriptional activity of AP-1 and promoted cell proliferation in kidney.
20331972 Taken together, this study provides novel insights into the energetic contributions of leucine zippers to the binding of bZIP domains of Jun transcription factor to DNA.
20331627 decrease of lung cancer cell proliferation by ZAK may involve the ERK and JNK pathways via an AP-1 transcription factor.
20306472 SARM-mediated inhibition may not be exclusively directed at TRIF or MyD88, but that SARM may also directly inhibit MAPK phosphorylation
20227498 MAP3 kinase COT1 is up-regulated by 1,25-dihydroxyvitamin D3 in parallel with activated c-jun during differentiation of human myeloid leukemia cells
20225236 This study demonstrated that IL-6 and high glucose synergistically stimulated MMP-1 expression in mononuclear phagocytes via ERK and JNK cascades and c-Jun upregulation.
20222112 This study is the first to show that TGF-beta induces CTGF expression through activation of Smad3 and activator protein 1 (AP-1) signaling pathways in nucleus pulposus cells.
20203690 Binding of G-1 compound to GPR30 in PC-3 prostate cancer cells is followed by sustained activation of Erk1/2 and a c-jun/c-fos-dependent upregulation of p21, resulting in the arrest of PC-3 growth at the G(2) phase.
20198339 Bile acid regulates MUC2 transcription in colon cancer cells via positive EGFR/PKC/Ras/ERK/CREB, PI3K/Akt/IkappaB/NF-kappaB and p38/MSK1/CREB pathways and negative JNK/c-Jun/AP-1 pathway.
20193273 PAR-2 activation induced by trypsin or SLIGKV-NH(2) promotes the proliferation of HepG2 cells partially via the ERK/AP-1 pathway.
20185758 These data together demonstrate the existence of a c-Jun-dependent mechanism regulating the abundance of the antiapoptotic DNp73 in response to genotoxic stress.
20170659 X-box binding protein 1 regulates brain natriuretic peptide through a novel AP1/CRE-like element in cardiomyocytes
20137127 The bone marrow microenvironment can inhibit the expression of AP-1, and promote myeloma cell proliferation and maintain cell survival.
20133937 the interaction of P(3)-25 with TRAF2 leads to inhibition of the NF-kappaB pathway and activation of AP-1 pathway
20093361 Wip1 (wild-type p53-induced phosphatase) expression is temporally induced by c-Jun and p53 in response to UV irradiation
20074357 In ovarian cancer cells highly responsive to lysophosphatidic acid (LPA), activation of AP-1 by LPA was suppressed by inhibition of EGFR while NF-kappaB was stimulated via the Gq-PKC pathway in an EGFR-independent manner.
20053993 Endogenous c-Jun contributes to ErbB2-induced mammary tumor cell invasion and self-renewal
20051654 Both NF-kappaB and c-Jun N-terminal kinase (JNK)/AP-1 pathways are important for matrix metalloproteinase-12 upregulation induced by tumor necrosis factor (TNF)-alpha in airway epithelial tumor A549 cells.
20044606 Amplification and overexpression of JUN may be rare in primary hepatocellular carcinoma.
20012528 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
19965873 Studies unravel the molecular basis for Gadkin-mediated AP-1 recruitment to TGN/endosomal membranes and identify a novel subtype of the AP-1-binding motif.
19959471 Studies present the first evidence demonstrating the role of the AP-1 complex in transcriptional down-regulation of the p27(Kip1) gene following mitogenic stimulation.
19944700 Stability and DNA-binding ability of the bZIP dimers formed by the ATF-2 and c-Jun.
19939924 endogenous Tpl2 promotes efficient murine gammaherpesvirus 68 lytic replication through AP-1-dependent upregulation of RTA expression
19937979 Up-regulation of TRPM6 transcriptional activity by AP-1 in renal epithelial cells.
19937141 increased expression in lymphoma cells undergoing glucose oxidase-mediated cell death
19921846 Jun-Fos heterodimer exhibits differential energetics in binding to genetic variants of TGACGTCA canonical motif.
19919900 The correlation between activator protein-1 and cholesteryl esters suggests that high activator protein-1 is a marker of carotid plaque vulnerability. Activator protein-1 expression can also reflect the activation of repair processes
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910471 The identification of c-Jun as a transcriptional regulator of PDK1 expression highlights key mechanisms underlying c-Jun oncogenic activity, and provides new insight into the nature of up-regulated Akt and PKC in melanoma.
19898747 Enteroaggregative Escherichia coli infection induces IL-8 production via activation of mitogen-activated protein kinases and the transcription factors NF-kappaB and AP-1.
19885545 activation of JNK/AP-1 or ERK/AP-1 pathway plays crucial roles in constitutive transactivation of MMP-1 in pancreatic cancer cell lines
19878434 Activation of activator protein-1 (AP-1) can induce cell death via non-transcriptional pathways in cultured cortical neurons.
19874574 Observational study of gene-disease association. (HuGE Navigator)
19860880 Human intron enhancer kappa (iE kappa) is active in Ig kappa-expressing nasopharyngeal carcinoma cells and LMP1-stimulated NF-kappaB and AP-1 activation results in an augmenting activation of the iE kappa.
19859790 c-Jun-NH2 terminal kinase (JNK)-mediates AP-1 activation by thioredoxin.
19841138 show that the clathrin adaptor AP-1 and the kinesin motor KIF13A together create peripheral recycling endosomal subdomains in melanocytes required for cargo delivery to maturing melanosomes.
19837979 JUN overexpression in multiple myeloma cells induced cell death and growth inhibition and up-regulated expression of early growth response protein 1.
19811296 following low dose X-irradiation, an increased activator protein 1 (AP-1) DNA-binding activity was observed in endothelial cells
19806201 JNK2 suppression of a novel JNK1/c-Jun/Bcl-3 apoptotic network hasa role in basal cancer cell survival
19795388 different levels of oxidative stress can regulate the expression of AP-1 transcription factors quantitatively in the human retinal pigment epithelium in vitro
19794957 Data evidenced that hypoxia decreased the responsiveness of HepG2 cells to etoposide at least by two independent pathways involving p53 inhibition and c-jun activation.
19787273 AP-1 activity in prostate cancer cells mediates EGF-R and PI3K signalling, is essential for their proliferation, and confers protection against radiation-induced cell death
19782465 lithocholic acid induces uPAR expression via Erk-1/2 and AP-1 pathway and, in turn, stimulate invasiveness of human colon cancer cells.
19758438 A high DNA binding activity and elevated expression of AP-1 proteins were observed in esophageal cancer.
19758340 c-Jun is rarely activated in normal skin and psoriasis in contrast to cutaneous lichen planus and squamous cell carcinoma.
19734233 The ability of interleukin (IL)-12 to enhance the cellular levels of c-jun was shown to be required for IL-12 to promote IL-10 production from human memory CD4-positive T cells.
19723051 Results suggest suggest that DHA-induced activation of AP-1 may mediate apoptosis of gastric cancer cells by inducing the expression of apoptotic genes in gastric cancer cells.
19714312 Results established that GATA2 and AP-1 Activator elements c-Jun/c-Fos act additively in modulating the SIRT3-VNTR enhancer function.
19701800 LNX and RhoC might be part of a larger protein complex that would have important functions in signaling transduction about regulating the transcriptional activities of AP-1.
19654329 a novel role of PBEF in the pathogenesis of acute lung injury and other inflammatory disorders via AP-1 dependent mechanism
19653276 Differential expression and activation of AP-1 super-family proteins in relation to severity of lesion and their crucial role in human oral carcinogenesis.
19616043 adrenomedullin is expressed in ovarian epithelial carcinoma tissue and bFGF can induce the expression of AM through the JNK-AP-1 pathway in ovarian epithelial carcinoma cell line CAOV(3)
19595408 The authors demonstrate that the repression of c-Jun activity in vivo is mainly due to the HBZ-SP1-mediated sequestration of c-Jun to the HBZ-NBs.[HBZ]
19591174 NAG7 plays a potential role in promoting nasopharyngeal carcinoma invasion by regulation of ERalpha and the H-ras/p-c-Raf and JNK2/AP-1/MMP1 signaling pathways.
19578717 ZCCHC12 enhanced the transcriptional activities of activator protein 1 (AP-1) and cAMP response element binding protein (CREB) as a coactivator
19531482 cAMP stringently regulates human cathelicidin antimicrobial peptide expression in the mucosal epithelial cells by activating cAMP-response element-binding protein, AP-1, and inducible cAMP early repressor
19528235 Results suggest that increased c-Jun expression due to mutant Shp2-induced Ras hyperactivation, and reduced GATA2 expression promote aberrant monocytic differentiation induced by activating PTPN11 mutants.
19513521 AP-1 proteins (jun/fos) are differentially expressed in ovarian tumors of differing malignant potential. No correlation with the proliferative and invasive potential of ovarian cancer cell lines could be found.
19499154 propose that NGX6 expression is lost in the process of human colorectal carcinogenesis. Its overexpression can inhibit expression of transcription factors AP-1 and Ets-1, and down-regulate transcriptional activity of the cyclin D1 promoter in human CRC
19495976 H. pylori in a Korean isolate induces the expression of COX-2 and iNOS via AP-1 activation, which may be mediated by Ras and the expression of c-Fos and c-Jun in gastric epithelial cells.
19435822 Findings indicate that AP-1 has an important function in pancreatic cancer cells and provide evidence for a previously unknown Akt-mediated mechanism of c-Jun activation.
19433309 These findings describe a novel function of c-FLIP-L involved in AP-1 activation and cell proliferation.
19384981 study found surface parameters for Fra-1 are similar in general to those of c-Fos and c-Jun; differences were found in the interactions of the three proteins with phospholipids
19358752 AP-1 binds to the p53 gene promoter region and regulates its expression in A549 cells.
19357699 BCR-ABL downregulates c-Jun expression by activating the PI3K-Akt pathway during chronic phase of chronic myeloid leukemia (CML-CP).
19334540 some transcriptional factors including AP-1 system of transcriptional factors are involved in pathological processes both under psoriasis and Crohn disease.
19306295 clinorotation upregulates iNOS in human umbilical vein endothelial cells by a mechanism dependent on suppression of AP-1, but not NF-kappaB
19281909 Human CD4(+) T cells express a functional H(4)R. The receptor is upregulated under T(H)2 conditions, and its stimulation leads to induction of AP-1 and IL-31.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19249008 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19238531 physiological protective effects of HES 130/0.4 in preventing oxidative stress in hemorrhagic shock appear to be mediated by down-regulation of the transcription factor NF-kappaB and AP-1
19231233 IFNgamma-stimulated mast cells induce productions of inflammatory cytokines through PKC/p38/NF-kappaB and AP-1 pathways, not through classical JAK/STAT1 pathway, in mast cells
19219074 A novel connection between HH/GLI pathway activity and JUN, which may contribute to the oncogenic activity of HH/GLI signaling in skin.
19215067 Data suggest that the single nucleotide variants of the TGACTCA motif modulate energetics and orientation of binding of the Jun-Fos heterodimer and that such behavior may be a critical determinant of differential regulation of specific genes.
19206162 Data suggest that mechanical signals are transmitted into the nucleus by ERK/JNK signaling pathways and then stimulate collagen type I expression through AP-1 activation in force-exposed human periodontal ligament fibroblasts.
19193763 Cell separation or abrogation of E-cadherin-mediated cell-cell contacts both cause a dramatic increase in accumulation of the c-Jun protein.
19176525 the phosphorylation of ATF-2 at Ser-121 plays a key role in the c-Jun-mediated activation of transcription that occurs in response to TPA.
19166930 Activated c-Jun is dimerized with JunD in response to adrenomedullin. Activation of cJun/JNK pathway is involved in the growth regulatory activity of adrenomedullin in glioblastoma cells.
19165171 Enhanced liver activation of the proinflammatory ppaB and AP-1 in obese patients with nonalcoholic fatty liver disease, parameters associaated with oxidative stress insulin resistance.
19164581 ablation of AP-1 function disrupts the cellular transformation and proliferation mediated by this oncogene. Data illustrate a novel mechanism required to couple mitogenic signals to the AP-1 gene regulatory program
19131506 GnRH regulation of Jun transcription requires a functional interaction between TCF/LEF and beta-catenin.
19123467 NF-kappaB repression and activation of AP-1 enhance apoptosis in prostate cancer cells
19105933 PDGF and TGF beta can strongly up-regulate c-fos and c-jun gene expressions in hepatic stellate T6 cells.
19080373 The ERK/AP-1 signaling pathway is responsible for SiO(2)-induced PAI-1 protein expression.
19035162 AP-1 may be a factor that can predict coronary arteriosclerotic progression and stability of the plaque.
19028685 The SAF-1.c-Fos.c-Jun ternary complex efficiently promotes transcription from both SAF-1 and AP-1 sites of human MMP-1 promoter.
19022561 both SF1 and LRH1 can transcriptionally cooperate with the AP-1 family members c-JUN and c-FOS, known to be associated with enhanced proliferation of endometrial carcinoma cells, to further enhance activation of the STAR, HSD3B2, and CYP19A1 PII promoters
19020743 EGF induces uPAR expression via ERK-1/2, AP-1, and NF-kappaB signaling pathways and, in turn, stimulates cell invasiveness in human gastric cancer AGS cells
19018257 AP-1 and PI3K/Akt pathways play an essential role in the growth of somenon-small cell lung cancer cells
19015316 Fast regulation of AP-1 activity through interaction of lamin A/C, ERK1/2, and c-Fos at the nuclear envelope.
18992165 Increased expression in colorectal adenomas, high-grade intraepithelial neoplasia and adenocarcinomas than in the adjacent normal epithelia
18957410 bexarotene increased the occupancy of the identified enhancer element in IGFBP-6 gene by RXRalpha, RARbeta, cJun, cFos, and p300
18952102 These results reveal the molecular bases of the expression specificity of PADI1 and PADI3 during keratinocyte differentiation through a long-range enhancer and support a model of PADI gene regulation depending on c-Jun-JunD competition.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18940179 bZIP domains of the Jun transcription factor bind to DNA as monomers prior to folding and homodimerization
18936204 Dose-dependent effects of rosmarinic acid on activator protein 1 activation of cyclooxygenase 2 in normal and neoplastic cells lines is reported.
18931081 Epstein Barr virus EBNA1 enhances activity of the AP-1 transcription factor in nasopharyngeal carcinoma cells.
18923650 Peptidylarginine deiminase Intergenic Enhancer is a strong enhancer of the PADI3 promoter in Ca2+-differentiated epidermal keratinocytes, and requires bound AP-1 factors, namely c-Jun and c-Fos
18845538 a novel function for Parkin in modulating the expression of Eg5 through the Hsp70-JNK-c-Jun signaling pathway.
18844221 NDRG2 modulates intracellular signals to control cell cycle through the regulation of cyclin D1 expression via phosphorylation pathway and down-regulation of AP-1
18838675 identify c-JUN and c-FOS as important regulators of human replication origin selection
18805449 These data suggest that c-Jun-N terminal kinase pathways are involved in oxidative stress-induced dopaminergic neuronal degeneration and pretreatment with selegiline affords neuroprotection by inhibiting these cell death-signaling pathways.
18775869 These results suggest that alpha5 gene expression is likely dictated by subtle alterations in the nuclear ratio of TFs that either repress (NFI) or activate (Sp1 and AP-1) alpha5 transcription in corneal epithelial cells.
18757369 a link between RhoA, JNK, c-Jun, and MMP2 activity that is functionally involved in the reduction in osteosarcoma cell invasion by the statin. This suggests a novel strategy targeting RhoA-JNK-c-Jun signaling to reduce osteosarcoma cell tumorigenesis.
18725194 The thermodynamics of heterodimerization of leucine zippers of Jun and Fos was characterized.
18708361 c-Jun down-regulation-mediated apoptosis in osteosarcoma cells involved caspase-1, caspase-2, and caspase-8, but not the Fas/FasL pathway.
18692129 activation of JNK1/AP-1 and subsequent IL-8 induction in hyperoxia are mediated by intracellular reactive oxygen species
18664273 Smad4 mediates transcriptional regulation through three mechanisms: Smad4 binding to a functional SBE site in the LAMA3 promoter, Smad4 binding to AP1 (and Sp1) sites via interaction with AP1 family, and Smad4 impact on transcription of AP1 factors
18653705 Activator protein-1 and smad proteins synergistically regulate human follicle-stimulating hormone beta-promoter activity.
18653452 (62)EEEE(65) plays a stabilizing role in the formation of a ternary complex between Nef, the MHC-I cytoplasmic domain, and AP-1
18650425 hypoxia/reoxygenation induces Plk3 activation instead of the JNK effect to directly phosphorylate and activate c-Jun, subsequently contributing to apoptosis in human corneal epithelial cells
18646516 Overexpression of p53 in human embryo lung fibroblasts induced by B(a)P could be through AP-1 independent pathways.
18644981 These results reveal a new AP-1 site within the TRAIL promoter functionally involved in TGF-beta-induced TRAIL expression and apoptosis in hepatomas.
18621151 LPS-induced c-fos and c-jun expressions are mediated by two different signaling pathways: one through phosphoinositide-phospholipase C, and the second through activation of protein kinase A (PKA).
18619508 nuclear c-Abl kinase can activate CSF-1 gene transcription by regulating AP-1 activity in the signaling events induced by L-selectin ligation.
18617512 Phosphorylation of Thr-178 and Thr-184 in the TAK1 T-loop is required for interleukin (IL)-1-mediated optimal NFkappaB and AP-1 activation as well as IL-6 gene expression.
18600430 HRG-beta-induced MMP-7 expression was regulated by HER2-mediated AP-1 activation in MCF-7 cells.
18597608 Thrombin Stimulation of c-jun mRNA expression showed biphasic responses with two peaks after 1 and 8 hours of exposure.
18572021 an important role of CDCA4 in the context of transcriptional regulation and cell fate determination through the JUN oncogene
18570890 ERK1/2 phosphorylation and c-Jun expression were significantly lowered in gastric cancer compared with the non-cancer adjacent tissues.
18543249 Concluded that IL-6/sIL-6R enhances cathepsin B and L production via IL-6/sIL-6R-mediated Cav-1-JNK-AP-1 pathway in human gingival fibroblasts.
18515365 Interleukin (IL) 1beta induction of IL-6 is mediated by a novel phosphatidylinositol 3-kinase-dependent AKT/IkappaB kinase alpha pathway targeting activator protein-1
18497564 Involvement of c-Jun in human liposarcoma growth: supporting data from clinical immunohistochemistry and DNAzyme efficacy.
18494816 These findings suggest that deregulation of AP-1 expression in primary cutaneous T-cell lymphoma is the result of aberrant expression of JUNB and possible JUND
18487146 The preliminary results showed that AC3-33 is an important novel gene related to supress AP-1 activity.
18485515 Increased intracellular ROS generation in peripheral blood monocytes of diabetic patients is involved in the pathogenesis of diabetic nephropathy via activation of AP-1.
18467434 GPR30-mediated inhibition of urothelial cell proliferation is the result of decreased cyclin D1 by down-regulation of activation protein-1 signaling.
18448277 Activation of c-Jun by the p53-dependent PI-3K/Akt/ERK pathway is responsible for B(a)P-induced cell cycle alternations in human embryo lung fibroblasts.
18445313 AP-1 activity and cyclin D1/E2F-1 expression in human embryo lung fibroblasts increased significantly after benzo(a)pyrene treatment.
18443043 Phosphorylation deficient c-jun was less able to recruit PCAF to AP-1 sites.
18443042 These data support the idea of an activator function of c-Jun that is executed by multiple mechanisms, including phosphorylation-dependent interaction with p65 NF-kappaB and HDAC3 at the level of chromatin.
18435914 A prominent role for ERK1/2 was shown in the TPA-induced activation of c-Jun regulating the Fra1 promoter.
18414033 c-jun downregulation results in apoptosis-mediated anti-osteosarcoma activity
18410487 AP-1 and AP-3 are involved in the formation of distinct types of clathrin-coated vesicles, each of which is characterized by the incorporation of specific cargo membrane proteins
18384814 activation protein 1 (AP-1) activates the miR-21 transcription in conjugation with the SWI/SNF complex
18352974 Transcription factor AP-1 does not seem to have a significant role in the pathological process.
18351441 expression of LDHAL6A was able to activate transcriptional activities of AP1(PMA)
18347071 Our results reveal a mechanism by which nuclear Dvl cooperates with c-Jun to regulate gene transcription stimulated by the canonical Wnt signaling pathway.
18322962 Over-expression of RASSF1A inhibits the growth of SGC7901 cells by negatively regulating the AP-1 activity, the latter in turn negatively signals cell proliferation.
18316603 c-Jun translocates B23 and ARF from the nucleolus after JNK activation by means of protein interactions
18316037 Binding of Jun-Fos bZIP domains to both tetradecanoylphorbol acetate (TRE) and CRE response elements is under enthalpic control and accompanied by entropic penalty at physiological temperatures.
18304423 Three kinds of immunological adjuvants, TNF alpha, CpG-ODN and CpG-ODN/HBsAg enhanced the expression of nucleic NF-kB and inhibited the expression of AP-1 in dendritic cells in chronic hepatitis B patients.
18302882 200 microg/ml silica exposure can induce AP-1 activation andinduce cell cycle changes through the ERK, JNK/AP-1-dependent pathway.
18281687 Transcriptional activation of the EGR-1 promoter by JNK-MKK7 or by IL-1 required a single upstream AP-1 site and three distal serum-response elements (SRE).
18262488 analysis of the structural polymorphism of a 21-bp Pu.Py DNA segment within human c-jun protooncogene 3'-region, a potential target for triplex formation
18253836 activator protein-1 (AP-1) was activated through phosphorylation of cJun and cFos, induced by JNK and p38, respectively.
18239671 Results suggest that secretogranin II represents a key AP-1-regulated protein that counteracts nitric oxide toxicity and mediates neuronal differentiation of neuroblastoma cells.
18234454 results reveal that especially NRF-1, along with AP-1 and, to a minor extent, an Sp1 site, is essential for human CAPNS1 promoter activity and gene expression
18192274 Sp1 recruits ATF3, c-Jun, and STAT3 to obtain the requisite synergistic effect in neuronal injury through DINE neuronal injury-inducible gene
18180316 study has demonstrated a robust augmentation by high glucose of lipopolysaccharide (LPS)-stimulated CD14 antigen expression through activator protein-1 (AP-1) and nuclear factor kappaB (NFkappaB)
18180292 in addition to its transcriptional effects, c-Jun regulates rRNA processing and nucleolar compartmentalization of the rRNA processing protein DDX21
18174157 17beta-estradiol induces ERRalpha gene expression in MCF-7 cells through active recruitment of co-activators and release of co-repressors when ERRalpha and AP1 bind and ERalpha is tethered to the multiple hormone-response element
18172215 analysis of a cross-talk between AP-1 and NF-kappaB
18171671 Basic fibroblast growth factor-induced neuronal differentiation of mouse bone marrow stromal cells requires FGFR-1, MAPK/ERK, and transcription factor AP-1
18097055 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
18073204 Nef binding to the MHC-I cytoplasmic tail stabilizes the interaction of a tyrosine in the MHC-I cytoplasmic tail with the natural tyrosine binding pocket in AP-1
18065414 ER stress increases MTHFR expression and IRE1 and c-Jun mediate this activation
18062835 Observational study of gene-disease association. (HuGE Navigator)
18032824 AP-1 and NF-kappaB transcription factors are activated and EGF-R is expressed in these cells and associated with COX-2 and VEGF production
17978573 HSP90 stabilizes c-Jun protein, and so increases the total activity of c-Jun in HEK293 cells.
17968316 dynamic changes of the COP1/COP1D ratio provide an additional level of regulation of the half-life of the substrates of this E3 ligase under homeostatic or pathological conditions
17952113 Calcineurin stabilizes c-Jun by dephosphorylating c-Jun at Ser-243 to enhance its tumorigenic ability
17940019 These findings demonstrate that c-Jun/AP-1 is hepatoprotective during acute hepatitis by regulating nos2/nitric oxide expression and thus functionally antagonizes the cell death-promoting functions of JNK.
17920329 c-Jun may sense the strength of genotoxic stress through DNA-damage dependent phosphorylation of T95, which in turn augments c-Jun transactivation by JNKs.
17914574 overexpression of c-Jun is associated with invasiveness and metastasis in breast cancer
17908424 JNK and ERK signaling pathways, but not p38 pathway regulate benzo(a)pyrene-induced c-Jun activation in human embryo lung fibroblasts.
17845581 Transactivation by AP-1 increased luciferase expression 85-fold, in the absence of stimulation. Synergistic interactions were demonstrated between Ets1, GATA-3 and AP-1.
17804415 Results show that Plk3 mediates UV irradiation-induced c-Jun activation by phosphorylating c-Jun, suggesting that Plk3 plays an important role in mediating programmed cell death of corneal epithelial cells after UV irradiation.
17761353 results suggest that HPE-induced IL-8 secretion occurs via activation of JNK/SAPK and transcription factors NF-kappaB and AP-1 in PMA-differentiated THP-1 cells
17703412 Observational study of gene-disease association. (HuGE Navigator)
17702894 These data suggest that stromally expressed c-Jun may promote prostatic epithelial proliferation through IGF-1 as a paracrine signal that, in turn, can promote prostate epithelial proliferation.
17681951 Dimerization with the Jun proteins inhibits c-Fos nuclear exit.
17672916 The present study confirms that overexpression of c-Jun contributes to metastasis of breast cancer.
17658605 These results suggest that SKAP55 modulates signal transduction from the T cell antigen receptor to Ras by binding to RasGRP1.
17652081 c-Jun nuclear import is mediated by multiple transport receptors
17651785 We conclude that Jab1 expression may lead to down-regulation of the negative cell cycle regulator p27(Kip1), pointing to a possible mechanism that promotes hepatocarcinogenesis.
17639289 Ras/MAPK cascade acts as the upstream signaling for AP-1 activation and IL-8 expression in toxin A-stimulated intestinal epithelial cells.
17637753 The AP-1 factor regulates the expression of cyclin D and E2F (the latter in turn regulates E2F-downstream genes), leading to cell cycle progression and breast cancer cell proliferation.
17636030 Amino acid residues required for physical and cooperative transcriptional interaction of STAT3 and API-1 proteins c-Jun and c-Fos.
17634427 These results imply that c-Jun plays a pivotal role in the pathway that connects ligand-activated AR to elevated ETV1 expression, leading to enhanced expression of matrix metalloproteinases and prostate cancer cell invasion.
17588603 Changes in AP-1 composition and the level of participating NFAT proteins can differentially influence cytokine gene expression, resulting in biological consequences for the modulation and dynamics of the immune response.
17510314 These data suggest that Src-induced u-PAR gene expression and invasion/intravasation in vivo is also mediated via AP-1 region -190/-171, especially bound with c-Jun phosphorylated at Ser(73/63).
17506864 the interaction between the hinge region and the GAE domain underlies the autoregulation of GGA function in clathrin-mediated trafficking through competing with the accessory proteins and the AP-1 complex
17495958 Coordinated down- and up-regulation of the various AP-1 subunits in the course of epidermal wound healing is important for its undisturbed progress, putatively by influencing inflammation and cell-cell communication.
17466952 Absence of CFTR at the cell membrane leads to an intrinsic AP1 activity.
17438848 AP-1 may participate in the signal transduction of PKC-triggered expression of IL-5 in allergic rhinitis T lymphocytes.
17403042 FasL-induced activator protein (AP)-1 activation is required for optimal IL-8 production.
17401435 1alpha-25(OH)2DHT(3) blocks TNF-induced monocytic tissue factor expression by inhibition of AP1 and NF-kappa b.
17390236 These results suggest that hLBH proteins may act as a transcriptional activator in mitogen-activated protein kinase signaling pathway to mediate cellular functions.
17317669 IGF-1 induces phosphorylation and an increase of the AP1 complex, which is phosphorylated and binds to the pS2/TFF1 promoter, allowing recruitment of the chromatin remodeling factor Brg1 followed by binding of ERalpha via its interaction with c-Jun
17314269 We will summarize the current knowledge regarding the implication of AP-1 proteins in respiratory epithelium carcinogenesis, highlight the ongoing research, and consider the future perspectives of their potential therapeutic interest.
17283046 c-Jun homodimers are recruited to the interleukin-1beta (IL-1beta) promoter in the absence of direct DNA binding via protein-protein interactions with DNA-anchored PU.1 and CCAAT/enhancer-binding protein beta (C/EBPbeta).
17283040 MCJ is required in these cells to prevent c-Jun-mediated expression of ABCB1 and maintain drug response.
17237407 IL-10 promoter activity was ablated by mutating two nonpolymorphic binding sites for the AP-1 transcription factor, and in primary human T cells, SDF-1 costimulation enhances AP-1 binding to both of these sites
17237388 Ral is activated upon BCR stimulation and mediates BCR-controlled activation of AP-1 and NFAT transcription factors.
17235455 These data indicate that the aberrant expression of PTEN contributes to the activation of the PI3kinase/Akt pathway and its transcription factor mediators in glioma.
17215518 These findings indicate the dephosphorylation of c-Jun C terminus is required for the c-Jun/Sp1 interaction and reveal that PP2B plays an important role in regulating c-Jun/Sp1 interaction in phorbol 12-myristate 13-acetate -induced gene expression.
17130130 activating protein 1 has a role in the transcriptional regulation of the human FCGR2B promoter mediated by the -343 G -> C polymorphism associated with systemic lupus erythematosus
17121851 a non-classical mechanism by which VDR acts as a c-Jun/AP-1 target gene to modify c-Jun activity in stress response through increased protein expression independent of classical transcriptional regulations
17101801 Apoptosis induced by osmotic stress was suppressed by overexpression of c-Jun, indicating that the downregulation of c-Jun promotes apoptosis.
17097050 AMPK mediates IL-2 production by regulating NF-AT and AP-1activation during T cell stimulation.
17088247 hyperactive variants of p38alpha induce, whereas hyperactive variants of p38gamma suppress, activating protein 1-mediated transcription
17085440 AP-1 protein degradation has roles in collagen gel-induced epithelial cell apoptosis
17074809 JNK1 and JNK2 differentially regulate TBP through Elk-1, controlling c-Jun expression and cell proliferation
17009014 Phosphorylated forms of MKK4, JNK, and c-Jun were detected in salivary infiltrating mononuclear cells of Sjogren's syndrome patients
16980310 Elafin inhibits the lipopolysaccharide-induced production of monocyte chemoattractant protein-1 in monocytes by inhibiting AP-1 and NF-kappaB activation.
16951171 JAB1 overexpression is involved in the pathogenesis of pancreatic cancer through JAB1-mediated p27 degradation and that control of JAB1 expression is a novel therapeutic target in patients with pancreatic adenocarcinomas.
16928756 temporal and dose-dependent interference by an AP-1 family member, c-Jun, upon NF-1 proteins binding an NF-1 consensus site derived from JC virus promoter sequence
16911523 These results indicate AP1-mediated upregulation of Bcl-X(L) expression is critical for protection of human gastric adenocarcinoma cells against adriamycin-induced apoptosis.
16905771 Crn7 interacts with AP-1 and is required for the maintenance of Golgi morphology and protein export from the Golgi
16895791 TNF-alpha down-regulates human Cu/Zn superoxide dismutase 1 promoter via JNK/AP-1 signaling pathway
16887814 CD226 promoters P1 and P2 are regulated by Ets-1 and AP-1
16844113 transcription factor, AP-1, was studied for its potential role in the hypoxia-induced protection against apoptosis. Specific inhibition of AP-1 decreased the protection effect of hypoxia against etoposide-induced apoptosis
16786139 PEA3 and c-Jun stimulate synergistically the HER2/neu gene transcription with p300
16702224 The effects of Cybr on nuclear factor of activated T cells and AP-1 are dependent on MAPK activation.
16690925 results indicate that HIV-1 Tat interacts with NFAT, affecting its cooperation with AP-1, without altering independent binding of these transcription factors to DNA
16690925 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
16676006 The data demonstrate that c-Jun contributes to the promotion of cellular survival by regulating the expression of PTEN.
16586042 Tacrolimus or cyclosporine A act on human osteoclast precursors in rheumatoid arthritis patients by targeting the calcineurin-dependent NFAT pathway and activation pathway for c-Jun or MITF.
16571680 SMAP2 functions in the retrograde, early endosome-to-trans golig network pathway in a clathrin- and AP-1-dependent manner.
16569638 matrix metalloproteinase-1 expression is regulated by JNK through Ets and AP-1 promoter motifs
16410250 Jab1 is an important effector that mediates a novel signal transduction pathway for PAR-2-dependent gene expression
16380075 AP-1 is a mediator of bile acid-induced liver cell apoptosis
16361535 The AP-1 site in the u-PAR promoter seems to be a less tumor-specific regulator than the Sp1 and AP-2 alpha.
16343055 PPARalpha activators LY-171883 and WY-14,643 were able to diminish transcriptional induction of COX-2 and VEGF by inhibiting AP-1 (activator protein-1)-mediated transcriptional activation.
16341687 gene is identified in proliferative diabetic retinopasathy.
16328781 Results suggest that VEGF induced by hyperbaric oxygen is through c-Jun/AP-1 activation, and through simultaneous activation of ERK and JNK pathways.
16303762 AP-1 is a key transcription factor that, in part, controls astrocyte-specific expression of genes including the ACT and GFAP genes
16289409 in vitro signaling pathway assay revealed that the JEV NS2B-NS3 protease significantly inhibited the signaling pathway of activator protein 1(AP1), a member of the bZIP family.
16285957 Galectin-3 up-regulation of MUC2 transcription occurs at the level of transcription through AP-1 activation in colon cancer cells
16266514 SiO(2) could induce AP-1 expression in A549 cells during the early part of exposure, but AP-1 levels gradually decreased with time.
16253992 demonstrates an important role of AP-1 and a member of the Ets family in the transcriptional regulation of C3aR expression, a prerequisite for the ability of C3a to participate in immunomodulation and inflammation
16243842 Vpr protein activates activator protein-1, c-Jun N-terminal kinase, and NF-kappaB and stimulates HIV-1 transcription in promonocytic cells and primary macrophages
16243842 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
16223572 deletion constructs of the promoter and mutational deletion of specific transcription factor binding sites indicated that Smad3/4 and AP-1 binding sites mediated the TGF-beta1 response on LTBP-3
16199533 results show that heparin affin regulatory peptide (HARP) is important for human prostate cancer cell proliferation and migration and establish role of activator protein-1 in up-regulation of HARP expression by low concentrations of hydrogen peroxide
16179804 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
16158054 Dysregulated c-jun expression may be involved in the acquisition of anchorage independence in the process of human lung carcinogenesis
16140218 Involucrin expression of keratinocytes is suppressed by roxithromycin through direct inhibition of AP-1 and indirect inhibition of NF-kappaB.
16123044 c-Fos represents a novel target for the isomerizing activity of Pin1, which has a role in the mechanism by which c-Jun and c-Fos cooperate to regulate AP-1-dependent gene transcription
16055710 c-Fos/c-Jun AP-1 dimer activity is downregulated by SUMO-1, SUMO-2, and SUMO-3
16049073 activity of the AP-1 components c-Jun, ATF2, and c-Fos is altered in renal cystic tissue of patients with autosomal dominant polycystic kidney disease
16001969 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
15994313 Histone deacetylase inhibitors suppress the induction of c-Jun and its target genes including COX-2
15991283 Activation of both NF-kappaB and AP-1 may be required for ICH-1L/S-induced apoptosis in hepatocellular carcinoma(HCC), but not for Fas/FasL-mediated apoptosis. NF-kappaB and AP-1 may play important roles in pathogenesis of human HCC.
15944151 chlorogenic acid stimulates Nrf2, inhibits activator protein-1, NF-kappaB, and MAPKs and induces phase 2 detoxifying enzyme activity
15941782 In conclusion, this study has demonstrated for the first time that sodium lactate and LPS exert synergistic effect on MMP and cytokine expression through NF-kappaB and MAPK pathways.
15936718 Overexpression of ZNF446 in COS-7 cells inhibits the transcriptional activities of SRE and AP-1.
15923644 TNF-alpha-induced CD44 expression was regulated by AP-1 through the activation of the CaMK-II pathway, whereas LPS-induced CD44 transcription was regulated specifically by Egr-1 through JNK activation.
15922298 Erg and Jun proteins interact in living cells
15897893 The proto-oncogene c-jun ia novel target gene of Aryl hydrocarbon receptor.
15894171 hepatopoietin association with thioredoxin constitutes a redox signal transduction in activation of AP-1/NF-kappaB
15870692 Activation of TrkA gene expression by methylation was considered to be caused by the direct interference of c-Jun binding to the negatively regulating AP-1-like site.
15863510 MMP-9 activity is inhibited by ascochlorin through suppression of AP-1-dependent induction of MMP-9 gene expression
15840658 JUN-dependent expression of PTN and SDF-1 in fibroblasts has a role in keratinocyte proliferation
15746191 Prolactin and estrogen cooperatively enhance the activity of AP-1 in in breast cancer cells.
15718494 Shear stress induces lipocalin-type prostaglandin D synthase expression by transcriptional activation through the AP-1 binding site
15708845 p38alpha and -beta mediate UV-induced, AP-1-mediated, c-Fos phosphorylation
15702969 Overexpression of a transfected gene encoding YB-1 in human HeLa cervical carcinoma cells significantly represses the transactivation of a minimal AP-1 reporter construct in response to the tumour promoter PMA.
15701643 p300 is essential for SENP1 to enhance c-Jun-dependent transcription because SENP1 can desumoylate the CRD1 domain of p300, thereby releasing the cis-repression of CRD1 on p300
15654976 enhanced expression of c-Jun in basal and suprabasal keratinocytes might contribute to the pathogenesis of psoriasis.
15642950 molecular mechanisms underlying ligand-dependent signaling in the ER/AP-1 pathway
15586248 c-Jun plays an important role in epidermal differentiation by negatively regulating the human involucrin gene.
15579469 induction of Smad7 gene expression by UV irradiation is mediated via induction of the transcription factor AP-1 in human skin fibroblasts
15550679 Glucocorticoid receptor mutant is able to distinguish between NF-kappaB and AP-1 repression.
15544846 evidence for an substance P-mediated induction of AP-1, which may contribute to the expression of pro-inflammatory cytokines
15530430 COBRA1 may directly modulate AP-1 pathway and, therefore, may play important roles in cell proliferation, differentiation, apoptosis, and oncogenesis.
15528994 Cooperation of CD99 engagement with suboptimal TCR/CD3 signals resulted in enhanced CD4+ T cell proliferation, elevated expression of CD25 and GM1, increased apoptosis, augmented activation of JNK, and increased AP-1 activation
15514030 expression of AP-1-dependent genes is inhibited by the cJun dominant negative; the AP-1 blockade does not affect mRNA ERalpha expression or estrogen induction of estrogen-responsive element activity
15507668 c-jun, junD, junB, and c-fos and Notch2 are expressed in splenic marginal zone lymphoma
15480426 Trx may regulate cell cycle and growth through a novel modulation of AP-1 activity and p27Kip1 degradation with Jab1
15469925 The visualization of ubiquitinated Jun in living cells has uncovered a lysosomal pathway for Jun degradation that involves ubiquitination by Itch/AIP4.
15385474 functional binding sites for NF-kappaB and AP-1 in the human beta-defensin-2 promoter are required for induction of hBD-2 through E. coli Nissle 1917
15383523 there is a novel association between TRAF2 and TRAF3 that is mediated by unique portions of each protein and that specifically regulates activation of NF-kappaB, but not AP-1
15378002 c-Jun is phosphorylated by the human vaccinia-related kinase 1 (VRK1) and cooperates with the N-terminal kinase of c-Jun (JNK)
15351693 transcriptional activities of ElK-1 and AP-1 are inhibited by TRIM45, a novel human RBCC/TRIM protein
15333603 results suggest that the modulation of p38 and c-jun may play an important role in the differentiation and proliferation of human endometrial cells
15314185 Data describe a possible mechanism by which NF-kappa B regulates the expression of c-Fos and AP-1 by controlling the expression of Elk-1.
15314183 These results define a novel regulatory pathway linking the transcription factors c-Jun, HERP2, and GATA-1.
15302867 c-Jun has a role in regulating p73 function
15271374 role in regulating interleukin-5 expression
15262961 AP-1 and JNK have roles in reactive oxygen species activation in tobacco-induced mucin production in lung cells
15258149 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
15249231 Overexpression of ZNF394 in the cell inhibits the transcriptional activities of c-Jun and AP-1 reporters.
15226448 data illustrate that NF-kappaB orchestrates immediate-early effects of LPS signaling and controls secondary AP-1 activation to mount an appropriate biological response
15191540 oxysterols induce specific AP-1 proteins, thereby activating involucrin, one of the genes required for epidermal differentiation.
15158360 a dominant negative mutant of c-Jun activates the interleukin-6 promoter
15087451 the well characterized basic leucine zipper domain of c-Jun functions in transcriptional activation by binding to the N terminus of hsTAF1 to derepress transcription
15034932 Results suggest that in human HL60 cells the presence of the AP-1 signal acts as a survival factor that determines the outcome of myc-induced proliferation or apoptosis.
15001576 AP1 and CHOP are induced by MEKK3 and have roles in TRAF7-related apoptosis
14739464 DET1 promotes ubiquitination and degradation of c-Jun by assembling a multisubunit ubiquitin ligase containing DNA Damage Binding Protein-1 (DDB1), cullin 4A (CUL4A), Regulator of Cullins-1 (ROC1), and constitutively photomorphogenic-1
14654548 An inverse correlation between JUN and p27(Kip1) expression levels in breast cancer.
14652666 findings demonstrate that activator protein-1 activation in human smooth muscle cells in response to angiotensin II and platelet-derived growth factor-AA is mediated via generation of p22phox-dependent reactive oxygen species
14645224 activator protein-1 is repressed by Notch-1 with C promoter-binding factor 1
14638681 c-Jun activity is modified by the estrogen receptor in the stress response
14532268 15d-PGJ2 covalently modifies c-Jun and directly inhibits the DNA binding activity of AP-1. In addition, 15d-PGJ2 can promote the oligomerization of a fraction of c-Jun through the formation of intermolecular disulfide bonds or 15d-PGJ2-bonded dimers.
14530285 NF-kappa B and AP-1 are required for basal MAT2A expression in HepG2 cells and mediate the increase in MAT2A expression in response to TNF-alpha
14511403 c-fos and AP-1 are regulated by JNK and p38 MAPK
14500675 Findings strongly suggest that the AP-1/JNK signaling pathway has little or no impact on the generation of inflammatory mediators in neutrophils.
12963995 c-Jun fails to act as a negative regulator for the cell survival of pancreatic cancer cells
12963547 JUN has a role in androgen stimulation which blocks p53-dependent transactivation of the Fas gene, which can be blocked by androgen stimulation during radiation-induced Fas sensitization in prostate cancer cells
12954631 transcription factors Sp1 and c-Jun have roles in regulation of keratin 16 gene expression by epidermal growth factor
12909593 The Ca2+-mediated increase in AP-1 binding may play an important role in upregulating AP-1-responsive gene expression, in stimulating pulmonary vascular cell proliferation and in pulmonary vascular remodeling in hypoxia-mediated pulmonary hypertension.
12875982 Data suggest that overexpression and binding of JunB to the AP-1 site may relieve the repression of the core promoter by CD30 in Hodgkin-Redd Sternberg cells, which provide one basis for the constitutive overexpression of CD30 in Hodgkin's lymphoma
12853483 The AP1 transcription factor c-jun is the prototypical nuclear effector of the JNK signal transduction pathway.
12815619 activator protein 1 and ERKs play crucial roles in FGF2-stimulated premature cranial suture closure
12799614 The expression of c-Jun protein and c-jun mRNA is significantly increased in the cerebellar vermis of patients with schizophrenia; no significant differences are found in the expression of Jun B or Jun D proteins.
12775419 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
12700665 c-Jun has an important functional role in the induction of cell cycle arrest and proliferation arrest of myeloid leukemia cells because of the ligation of the cell surface adhesion receptor CD44 by anti-CD44 antibody.
12692226 data demonstratre that c-Jun physically and functionally interacts with JCV major early regulatory protein large T-Ag and that this interaction modulates JCV transcription and replication in glial cells
12682910 Critical role of the transcription factor AP-1 for the constitutive and interferon-induced expression of IFI 16.
12618758 AP-1 (c-Jun & FosB) binds to a site in the 5' untranslated region of the CD95L gene. Transdominant negative Jun mutants reduce CD95L promoter activity. FosB dimerized with c-Jun has an important role in TCR/CD3-mediated activation-induced cell death.
12600818 conclude that Ras regulates TNF-alpha-induced chemokine expression by activating the AP-1 pathway and enhancing transcriptional function of NF-kappaB, whereas MEKK1 activates both the AP-1 and NF-kappaB pathways
12592382 Phosphorylation of c-jun was induced by TPA only. On the other hand, expression of proto-oncogene c-jun was induced by TPA and Saikosaponin a during 30 min to 6 h of treatment.
12547826 Tumor promoter arsenite stimulates histone H3 phosphoacetylation of c-fos and this proto-oncogene chromatin in diploid fibroblasts.
12485413 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
12446585 studies suggest that the cooperative interaction of the estrogen receptor with Fos and Jun proteins helps confer estrogen responsiveness to the endogenous progesterone receptor gene
12441106 results suggest strongly that human amylin induces apoptosis in pancreatic islet beta-cells through stimulation of expression and activation of c-Jun
12437352 structurally distinct modes of recognition of the KIX domain of CBP by CREB and this protein
12419805 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
12186939 Epstein-Barr virus latent membrane protein 2A may exploit MAPK kinases and affect both the phosphorylation and stability of c-Jun protein
12183893 Review.AP1 plays a crucial role during human papillomavirus (HPV) early gene expression, in particular of the expression of E6 and E7 oncoproteins.
12145210 Aberrantly expressed c-Jun and JunB are a hallmark of Hodgkin lymphoma cells, stimulate proliferation and synergize with NF-kappa B.
12119282 Kip1 inhibits Jab1 mediated c-Jun dependent transcription
12089333 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
12034730 c-Jun associates with the oncoprotein Ski and suppresses Smad2 transcriptional activity
11956220 Activation of human monoamine oxidase B gene expression by a protein kinase C MAPK signal transduction pathway involves c-Jun and Egr-1.
11914583 Functional role of ERK1/2 activation in phorbol ester-induced promoter activation of human 12(S)-lipoxygenase gene.
11909859 Analysis of heterophilic and homophilic interactions of cadherins using the c-Jun/c-Fos dimerization domains
11903046 An alternative model of H ferritin promoter transactivation by c-Jun (H ferritin, also called isoferritin)
11891317 Bombesin antagonists inhibit growth of MDA-MB-435 estrogen-independent breast cancers and decrease the expression of the ErbB-2/HER-2 oncoprotein and c-jun and c-fos oncogenes
11891228 c-Jun regulates vascular smooth muscle cell growth and neointima formation after arterial injury
11448159 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
11260070 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
11254713 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
10799874 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
10644332 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
10581001 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
10509564 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
10388555 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
10027715 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
9670954 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
9621077 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
9223324 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
9129988 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
8621941 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
8480425 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
7957556 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
7690421 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat
7642615 c-JUN enhances HIV-1 Tat-mediated LTR transcription but suppresses basal LTR transcription in the absence of Tat

AA Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK      1 - 70
LASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGA     71 - 140
GMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHH    141 - 210
LPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARL    211 - 280
EEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF                       281 - 331
//

Text Mined References (836)

PMID Year Title
27089238 2016 The oncogenic transcription factor c-Jun regulates glutaminase expression and sensitizes cells to glutaminase-targeted therapy.
26988982 2016 IL-17 mediates inflammatory reactions via p38/c-Fos and JNK/c-Jun activation in an AP-1-dependent manner in human nucleus pulposus cells.
26858249 2016 Inhibitor of Differentiation/DNA Binding 1 (ID1) Inhibits Etoposide-induced Apoptosis in a c-Jun/c-Fos-dependent Manner.
26832411 2016 Tead and AP1 Coordinate Transcription and Motility.
26799482 2016 Differential Expression of the Activator Protein 1 Transcription Factor Regulates Interleukin-1ß Induction of Interleukin 6 in the Developing Enterocyte.
26792858 2016 AP-1 Is a Key Regulator of Proinflammatory Cytokine TNF?-mediated Triple-negative Breast Cancer Progression.
26747248 2016 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26719067 2016 Downregulation of non?muscle myosin IIA expression inhibits migration and invasion of gastric cancer cells via the c?Jun N?terminal kinase signaling pathway.
26707143 2016 Curcumin enhances the antitumor effect of ABT-737 via activation of the ROS-ASK1-JNK pathway in hepatocellular carcinoma cells.
26631725 2016 Purinergic P2Y2 Receptor Control of Tissue Factor Transcription in Human Coronary Artery Endothelial Cells: NEW AP-1 TRANSCRIPTION FACTOR SITE AND NEGATIVE REGULATOR.
26581505 2015 Selective participation of c-Jun with Fra-2/c-Fos promotes aggressive tumor phenotypes and poor prognosis in tongue cancer.
26562662 2015 Interleukin (IL)-1? Is a Strong Inducer of IL-36? Expression in Human Colonic Myofibroblasts.
26540629 2015 Palbociclib inhibits epithelial-mesenchymal transition and metastasis in breast cancer via c-Jun/COX-2 signaling pathway.
26530832 2015 MITF and c-Jun antagonism interconnects melanoma dedifferentiation with pro-inflammatory cytokine responsiveness and myeloid cell recruitment.
26497679 2015 Tristetraprolin induces cell cycle arrest in breast tumor cells through targeting AP-1/c-Jun and NF-?B pathway.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26493679 2016 CREB, AP-1, ternary complex factors and MAP kinases connect transient receptor potential melastatin-3 (TRPM3) channel stimulation with increased c-Fos expression.
26476743 2016 Extracellular histones induce tissue factor expression in vascular endothelial cells via TLR and activation of NF-?B and AP-1.
26459591 2015 Expression of the Robo4 receptor in endothelial cells is regulated by two AP-1 protein complexes.
26426522 2016 Restoration of Corticosteroid Sensitivity in Chronic Obstructive Pulmonary Disease by Inhibition of Mammalian Target of Rapamycin.
26418950 2015 Apoptosis induced by temozolomide and nimustine in glioblastoma cells is supported by JNK/c-Jun-mediated induction of the BH3-only protein BIM.
26397987 2015 Mitochondrial dysfunction induces EMT through the TGF-?/Smad/Snail signaling pathway in Hep3B hepatocellular carcinoma cells.
26394174 2015 C-Jun NH2-Terminal Kinase and p38 Inhibition Suppresses Prostaglandin E2-Stimulated Aromatase and Estrogen Receptor Levels in Human Endometriosis.
26336885 2015 Prognostic value of HMGA2, CDK4, and JUN amplification in well-differentiated and dedifferentiated liposarcomas.
26287601 2015 NCOA1 promotes angiogenesis in breast tumors by simultaneously enhancing both HIF1?- and AP-1-mediated VEGFa transcription.
26280733 2015 Progesterone and the Repression of Myometrial Inflammation: The Roles of MKP-1 and the AP-1 System.
26260845 2015 NF?B- and AP-1-mediated DNA looping regulates matrix metalloproteinase-9 transcription in TNF-?-treated human leukemia U937 cells.
26136365 2015 Transport of the cholera toxin B-subunit from recycling endosomes to the Golgi requires clathrin and AP-1.
26035356 2015 Overexpression of MAPK15 in gastric cancer is associated with copy number gain and contributes to the stability of c-Jun.
26018080 2015 Interplay between TAp73 Protein and Selected Activator Protein-1 (AP-1) Family Members Promotes AP-1 Target Gene Activation and Cellular Growth.
25945750 2015 HP1a/KDM4A is involved in the autoregulatory loop of the oncogene gene c-Jun.
25895972 2015 AP-1 Transcription Factor Serves as a Molecular Switch between Chlamydia pneumoniae Replication and Persistence.
25865119 2015 Decoding the regulatory landscape of melanoma reveals TEADS as regulators of the invasive cell state.
25813203 2016 The expression levels of JunB, JunD and p-c-Jun are positively correlated with tumor cell proliferation in diffuse large B-cell lymphomas.
25771902 2015 Immunohistochemical analysis of the expression of cellular transcription NF?B (p65), AP-1 (c-Fos and c-Jun), and JAK/STAT in leprosy.
25710583 2016 The Differential Immunohistochemical Expression of p53, c-Jun, c-Myc, and p21 Between HCV-related Hepatocellular Carcinoma With and Without Cirrhosis.
25684043 2015 Quinacrine induces apoptosis in human leukemia K562 cells via p38 MAPK-elicited BCL2 down-regulation and suppression of ERK/c-Jun-mediated BCL2L1 expression.
25670814 2015 O-GlcNAcylation of MLL5? is essential for MLL5?-AP-1 transcription complex assembly at the HPV16/18-long control region.
25656613 2015 REG I? activates c-Jun through MAPK pathways to enhance the radiosensitivity of squamous esophageal cancer cells.
25647783 2015 ERK1/2 promoted proliferation and inhibited apoptosis of human cervical cancer cells and regulated the expression of c-Fos and c-Jun proteins.
25625784 2015 miR-29c is downregulated in the ectopic endometrium and exerts its effects on endometrial cell proliferation, apoptosis and invasion by targeting c-Jun.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25600770 2015 Twist1 and AP-1 cooperatively upregulate integrin ?5 expression to induce invasion and the epithelial-mesenchymal transition.
25571870 2015 RNAi-mediated knockdown of the c-jun gene sensitizes radioresistant human nasopharyngeal carcinoma cell line CNE-2R to radiation.
25545366 2015 miR-1470 mediates lapatinib induced p27 upregulation by targeting c-jun.
25544773 2015 Targeting the microRNA-21/AP1 axis by 5-fluorouracil and pirarubicin in human hepatocellular carcinoma.
25536346 2014 Oxidant exposure induces cysteine-rich protein 61 (CCN1) via c-Jun/AP-1 to reduce collagen expression in human dermal fibroblasts.
25533033 2015 Jun-regulated genes promote interaction of diffuse large B-cell lymphoma with the microenvironment.
25526895 2015 Mucin1 mediates autocrine transforming growth factor beta signaling through activating the c-Jun N-terminal kinase/activator protein 1 pathway in human hepatocellular carcinoma cells.
25499265 2015 Involvement of aberrant miR-139/Jun feedback loop in human gastric cancer.
25483191 2014 TGF?-induced invasion of prostate cancer cells is promoted by c-Jun-dependent transcriptional activation of Snail1.
25477266 2015 IL-6, IL-10, c-Jun and STAT3 expression in B-CLL.
25476526 2015 Xylosyltransferase-1 expression is refractory to inhibition by the inflammatory cytokines tumor necrosis factor ? and IL-1? in nucleus pulposus cells: novel regulation by AP-1, Sp1, and Sp3.
25463304 2015 Down-regulation of aldo-keto reductase AKR1B10 gene expression by a phorbol ester via the ERK/c-Jun signaling pathway.
25435485 2015 p38 Mitogen-activated protein kinase and c-Jun NH2-terminal protein kinase regulate the accumulation of a tight junction protein, ZO-1, in cell-cell contacts in HaCaT cells.
25428452 2015 HBx induces the proliferation of hepatocellular carcinoma cells via AP1 over-expressed as a result of ER stress.
25422452 2014 Acquisition of an immunosuppressive protumorigenic macrophage phenotype depending on c-Jun phosphorylation.
25386557 2014 Downregulation of MDR1 gene by cepharanthine hydrochloride is related to the activation of c-Jun/JNK in K562/ADR cells.
25338512 2015 The actin and Rho-modifying toxins PTC3 and PTC5 of Photorhabdus luminescens: enzyme characterization and induction of MAL/SRF-dependent transcription.
25318890 2014 Hypoxia-induced autophagy contributes to radioresistance via c-Jun-mediated Beclin1 expression in lung cancer cells.
25281386 2015 The RNA-binding protein RBPMS1 represses AP-1 signaling and regulates breast cancer cell proliferation and migration.
25271301 2014 Integrated omic analysis of oropharyngeal carcinomas reveals human papillomavirus (HPV)-dependent regulation of the activator protein 1 (AP-1) pathway.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25239830 2014 c-Jun transcriptionally regulates alpha 1, 2-fucosyltransferase 1 (FUT1) in ovarian cancer.
25230788 2015 miR-1285-3p acts as a potential tumor suppressor miRNA via downregulating JUN expression in hepatocellular carcinoma.
25205654 2014 miR200c attenuates P-gp-mediated MDR and metastasis by targeting JNK2/c-Jun signaling pathway in colorectal cancer.
25205054 2015 Epithelial-to-mesenchymal transition induced by TGF-?1 is mediated by AP1-dependent EpCAM expression in MCF-7 cells.
25204501 2014 Astrocyte elevated gene-1 (AEG-1) promotes osteosarcoma cell invasion through the JNK/c-Jun/MMP-2 pathway.
25201048 2015 Sphingosine-1-phosphate mediates COX-2 expression and PGE2 /IL-6 secretion via c-Src-dependent AP-1 activation.
25200491 2014 FSL-1 induces MMP-9 production through TLR-2 and NF-?B /AP-1 signaling pathways in monocytic THP-1 cells.
25199502 2014 Comparison of the molecular topologies of stress-activated transcription factors HSF1, AP-1, NRF2, and NF-?B in their induction kinetics of HMOX1.
25077945 2014 Endoplasmic reticulum stress activates the hepatic activator protein 1 complex via mitogen activated protein kinase-dependent signaling pathways.
25070240 2014 ISL-1 is overexpressed in non-Hodgkin lymphoma and promotes lymphoma cell proliferation by forming a p-STAT3/p-c-Jun/ISL-1 complex.
25047843 2014 Porphyromonas gingivalis-induced reactive oxygen species activate JAK2 and regulate production of inflammatory cytokines through c-Jun.
25031700 2014 Brain edema and protein expression of c-Fos and c-Jun in the brain after diffused brain injury.
25016017 2014 Cooperative signaling via transcription factors NF-?B and AP1/c-Fos mediates endothelial cell STIM1 expression and hyperpermeability in response to endotoxin.
24931237 2014 Three transcription factors and the way immune cells affected by different plasma change in opposite ways in the development of the syndrome of pre-eclampsia.
24914133 2014 Hydroxyurea-inducible SAR1 gene acts through the Gi?/JNK/Jun pathway to regulate ?-globin expression.
24913175 2014 Downregulation of cellular c-Jun N-terminal protein kinase and NF-?B activation by berberine may result in inhibition of herpes simplex virus replication.
24912525 2014 HIV-1 Vpr stimulates NF-?B and AP-1 signaling by activating TAK1.
24884571 2014 Attenuated neuroprotective effect of riboflavin under UV-B irradiation via miR-203/c-Jun signaling pathway in vivo and in vitro.
24852265 2014 c-Jun promotes cell migration and drives expression of the motility factor ENPP2 in soft tissue sarcomas.
24830720 2014 Genome-wide profiling of AP-1-regulated transcription provides insights into the invasiveness of triple-negative breast cancer.
24819052 2014 The LIM domain protein nTRIP6 recruits the mediator complex to AP-1-regulated promoters.
24796531 2014 Differentiation-associated genes regulated by c-Jun and decreased in the progression of esophageal squamous cell carcinoma.
24780373 2014 Regulatory roles of c-jun in H5N1 influenza virus replication and host inflammation.
24753227 2014 Resveratrol stimulates AP-1-regulated gene transcription.
24743307 2014 The sequence-specific transcription factor c-Jun targets Cockayne syndrome protein B to regulate transcription and chromatin structure.
24707477 2014 Histone deacetylase inhibitor impairs plasminogen activator inhibitor-1 expression via inhibiting TNF-?-activated MAPK/AP-1 signaling cascade.
24679696 2014 Determination of protein phosphatase type 2A in monocytes from multiple trauma patients: a potential biomarker for sepsis.
24658403 2014 HIV-1 Nef induces CCL5 production in astrocytes through p38-MAPK and PI3K/Akt pathway and utilizes NF-kB, CEBP and AP-1 transcription factors.
24641824 2014 Degraded ?-carrageenan activates NF-?B and AP-1 pathways in macrophages and enhances LPS-induced TNF-? secretion through AP-1.
24636898 2014 p300 cooperates with c-Jun and PARP-1 at the p300 binding site to activate RhoB transcription in NSC126188-mediated apoptosis.
24631457 2014 The role of c-Jun in controlling the EPAC1-dependent induction of the SOCS3 gene in HUVECs.
24623306 2014 A KRAS-directed transcriptional silencing pathway that mediates the CpG island methylator phenotype.
24606718 2014 Hyaluronan-CD44 interaction promotes c-Jun signaling and miRNA21 expression leading to Bcl-2 expression and chemoresistance in breast cancer cells.
24587316 2014 Tumour necrosis factor-? regulates human eosinophil apoptosis via ligation of TNF-receptor 1 and balance between NF-?B and AP-1.
24574500 2014 Identification of two forms of TNF tolerance in human monocytes: differential inhibition of NF-?B/AP-1- and PP1-associated signaling.
24566851 2014 c-Jun transactivates Puma gene expression to promote osteoarthritis.
24559171 2014 Cancer/testis antigen PAGE4, a regulator of c-Jun transactivation, is phosphorylated by homeodomain-interacting protein kinase 1, a component of the stress-response pathway.
24526449 2014 Nonuniform molecular features of myelinating Schwann cells in models for CMT1: distinct disease patterns are associated with NCAM and c-Jun upregulation.
24500404 2014 Molecular network analysis of endometriosis reveals a role for c-Jun-regulated macrophage activation.
24481121 2014 The role of sLZIP in transcriptional regulation of c-Jun and involvement in migration and invasion of cervical cancer cells.
24447950 2014 Interplay between viral Tat protein and c-Jun transcription factor in controlling LTR promoter activity in different human immunodeficiency virus type I subtypes.
24439903 2014 Chlamydia trachomatis-induced alterations in the host cell proteome are required for intracellular growth.
24375836 2014 MiR-92a mediates AZD6244 induced apoptosis and G1-phase arrest of lymphoma cells by targeting Bim.
24369359 2014 Concurrent MCL1 and JUN amplification in pseudomyxoma peritonei: a comprehensive genetic profiling and survival analysis.
24366551 2014 Protein kinase C-? downregulates estrogen receptor-? by suppressing c-Jun phosphorylation in estrogen receptor-positive breast cancer cells.
24366538 2014 GLI1 upregulates C-JUN through a specific 130-kDa isoform.
24335313 2014 Sirtuin 1 regulates hepatitis B virus transcription and replication by targeting transcription factor AP-1.
24291398 2014 KRIT1 loss of function causes a ROS-dependent upregulation of c-Jun.
24265756 2013 Involvement of AP-1 and C/EBP? in upregulation of endothelin B (ETB) receptor expression in a rodent model of glaucoma.
24263171 2014 The Stress-response protein prostate-associated gene 4, interacts with c-Jun and potentiates its transactivation.
24190040 2013 Truncated serine/arginine-rich splicing factor 3 accelerates cell growth through up-regulating c-Jun expression.
24113186 2013 Multisite phosphorylation of c-Jun at threonine 91/93/95 triggers the onset of c-Jun pro-apoptotic activity in cerebellar granule neurons.
24100343 2014 M-CSF cooperating with NF?B induces macrophage transformation from M1 to M2 by upregulating c-Jun.
24091941 2013 Human TTC5, a novel tetratricopeptide repeat domain containing gene, activates p53 and inhibits AP-1 pathway.
24073601 2014 Increased expression of c-Fos, c-Jun and c-Jun N-terminal kinase associated with neuronal cell death in retinas of diabetic patients.
24038602 2014 The AP-1 transcription factor JunD activates the leukocyte immunoglobulin-like receptor 1 distal promoter.
24038215 2014 Inhibition of apolipoprotein A-I expression by TNF-alpha in HepG2 cells: requirement for c-jun.
24029232 2013 Protein kinase C ? is a central signaling node and therapeutic target for breast cancer stem cells.
24027432 2013 COP1 and GSK3? cooperate to promote c-Jun degradation and inhibit breast cancer cell tumorigenesis.
24004834 2013 Helicobacter pylori promotes invasion and metastasis of gastric cancer cells through activation of AP-1 and up-regulation of CACUL1.
23942796 2013 The prognostic significance of Jun transcription factors in ovarian cancer.
23929433 2014 miR-23a inhibits E-cadherin expression and is regulated by AP-1 and NFAT4 complex during Fas-induced EMT in gastrointestinal cancer.
23922701 2013 Overexpressed DNA polymerase iota regulated by JNK/c-Jun contributes to hypermutagenesis in bladder cancer.
23906792 2013 Connective tissue growth factor induces collagen I expression in human lung fibroblasts through the Rac1/MLK3/JNK/AP-1 pathway.
23844083 2013 Protein kinase R modulates c-Fos and c-Jun signaling to promote proliferation of hepatocellular carcinoma with hepatitis C virus infection.
23835612 2013 (-)-Epigallocatechin-3-gallate blocks nicotine-induced matrix metalloproteinase-9 expression and invasiveness via suppression of NF-?B and AP-1 in endothelial cells.
23832539 2013 Transcription factor AP1 binds the functional region of the promoter and regulates gene expression of human PPARdelta in LoVo cell.
23818969 2013 p21-activated kinase 3 (PAK3) is an AP-1 regulated gene contributing to actin organisation and migration of transformed fibroblasts.
23814048 2013 Interaction of glucocorticoid receptor (GR) with estrogen receptor (ER) ? and activator protein 1 (AP1) in dexamethasone-mediated interference of ER? activity.
23770289 2013 Interleukin-5 enhances the migration and invasion of bladder cancer cells via ERK1/2-mediated MMP-9/NF-?B/AP-1 pathway: involvement of the p21WAF1 expression.
23762330 2013 A feedback inhibition between miRNA-127 and TGF?/c-Jun cascade in HCC cell migration via MMP13.
23752183 2014 Parathyroid hormone-related protein inhibits DKK1 expression through c-Jun-mediated inhibition of ?-catenin activation of the DKK1 promoter in prostate cancer.
23749999 2013 Cleavage of the JunB transcription factor by caspases generates a carboxyl-terminal fragment that inhibits activator protein-1 transcriptional activity.
23747343 2013 Estrogen receptor-? mediates human multidrug resistance associated protein 3 induction by 17?-ethynylestradiol. Role of activator protein-1.
23720779 2013 X-linked inhibitor of apoptosis protein (XIAP) regulation of cyclin D1 protein expression and cancer cell anchorage-independent growth via its E3 ligase-mediated protein phosphatase 2A/c-Jun axis.
23690655 2013 p38/AP-1 pathway in lipopolysaccharide-induced inflammatory responses is negatively modulated by electrical stimulation.
23686163 2013 Notch inhibition restores TRAIL-mediated apoptosis via AP1-dependent upregulation of DR4 and DR5 TRAIL receptors in MDA-MB-231 breast cancer cells.
23682787 2013 Anticancer activity of Phyllanthus emblica Linn. (Indian gooseberry): inhibition of transcription factor AP-1 and HPV gene expression in cervical cancer cells.
23671702 2013 Curcumin nanoparticles ameliorate ICAM-1 expression in TNF-?-treated lung epithelial cells through p47 (phox) and MAPKs/AP-1 pathways.
23669365 2013 Rhomboid domain containing 1 inhibits cell apoptosis by upregulating AP-1 activity and its downstream target Bcl-3.
23665993 2014 Regulation of bcl-2 transcription by estrogen receptor-? and c-Jun in human endometrium.
23665382 2013 NFATc2 recruits cJun homodimers to an NFAT site to synergistically activate interleukin-2 transcription.
23625206 2013 Effect of estrogen and tamoxifen on the expression pattern of AP-1 factors in MCF-7 cells: role of c-Jun, c-Fos, and Fra-1 in cell cycle regulation.
23625009 2013 Latency of Epstein-Barr virus is disrupted by gain-of-function mutant cellular AP-1 proteins that preferentially bind methylated DNA.
23624934 2013 Arginine methylation of the c-Jun coactivator RACO-1 is required for c-Jun/AP-1 activation.
23615400 2013 Proteomic analysis reveals that pardaxin triggers apoptotic signaling pathways in human cervical carcinoma HeLa cells: cross talk among the UPR, c-Jun and ROS.
23614275 Influence of genistein on c-Jun, c-Fos and Fos-B of AP-1 subunits expression in skin keratinocytes, fibroblasts and keloid fibroblasts cultured in vitro.
23608488 2013 IL-4 inhibition of IL-1 induced Matrix metalloproteinase-3 (MMP-3) expression in human fibroblasts involves decreased AP-1 activation via negative crosstalk involving of Jun N-terminal kinase (JNK).
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23583295 2013 Transcriptional regulation of increased CCL2 expression in pulmonary fibrosis involves nuclear factor-?B and activator protein-1.
23580428 2013 Hepatitis C virus core+1/ARF protein decreases hepcidin transcription through an AP1 binding site.
23578467 2013 Early cell-cycle gene expression in T-cells after hematopoietic stem cell transplantation.
23562910 2013 Loss of FMR2 further emphasizes the link between deregulation of immediate early response genes FOS and JUN and intellectual disability.
23546882 2013 MicroRNA-144 is regulated by activator protein-1 (AP-1) and decreases expression of Alzheimer disease-related a disintegrin and metalloprotease 10 (ADAM10).
23523566 2013 Transcriptional activity of c-Jun is critical for the suppression of AR function.
23467542 2013 Both NF-?B and c-Jun/AP-1 involved in anti-?2GPI/?2GPI-induced tissue factor expression in monocytes.
23455325 2014 Aberrant IKK? and IKK? cooperatively activate NF-?B and induce EGFR/AP1 signaling to promote survival and migration of head and neck cancer.
23454483 2013 Elk1 and AP-1 sites in the TBP promoter mediate alcohol-induced deregulation of Pol III-dependent genes.
23437118 2013 Activation of TGF-?1 promoter by hepatitis C virus-induced AP-1 and Sp1: role of TGF-?1 in hepatic stellate cell activation and invasion.
23404530 2013 Pioglitazone inhibits high glucose-induced synthesis of extracellular matrix by NF-?B and AP-1 pathways in rat peritoneal mesothelial cells.
23404426 2013 Inhibition of proliferation of estrogen receptor?positive MCF?7 human breast cancer cells by tamoxifen through c?Jun transcription factors.
23396363 2014 SUMOylation of the inducible (c-Fos:c-Jun)/AP-1 transcription complex occurs on target promoters to limit transcriptional activation.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23362975 2013 Expression of c-Jun and Sox-2 in human schwannomas and traumatic neuromas.
23339184 2013 Microenvironmental regulation of BRCA1 gene expression by c-Jun and Fra2 in premalignant human ovarian surface epithelial cells.
23331079 2013 Interleukin-1? enhances cell migration through AP-1 and NF-?B pathway-dependent FGF2 expression in human corneal endothelial cells.
23300800 2012 Butyrate produced by commensal bacteria potentiates phorbol esters induced AP-1 response in human intestinal epithelial cells.
23269699 2013 Elevated cJUN expression and an ATF/CRE site within the ATF3 promoter contribute to activation of ATF3 transcription by the amino acid response.
23236059 2013 An AP-1 binding site in the enhancer/core element of the HIV-1 promoter controls the ability of HIV-1 to establish latent infection.
23226410 2012 Cell specific CD44 expression in breast cancer requires the interaction of AP-1 and NF?B with a novel cis-element.
23223231 2013 Regulation of xylosyltransferase I gene expression by interleukin 1? in human primary chondrocyte cells: mechanism and impact on proteoglycan synthesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23182717 2013 Upregulation of genes for C-reactive protein and related pentraxin/complement proteins in photodynamic therapy-treated human tumor cells: enrolment of PI3K/Akt and AP-1.
23163821 2013 Transcription factor complex AP-1 mediates inflammation initiated by Chlamydia pneumoniae infection.
23153494 2012 The NF-?B signaling protein Bcl10 regulates actin dynamics by controlling AP1 and OCRL-bearing vesicles.
23135283 2012 PAX2 protein induces expression of cyclin D1 through activating AP-1 protein and promotes proliferation of colon cancer cells.
23047699 2012 Human serum protein enhances HIV-1 replication and up-regulates the transcription factor AP-1.
23041974 2012 Liver cancer initiation is controlled by AP-1 through SIRT6-dependent inhibition of survivin.
23028371 2012 Tethering of the conserved piggyBac transposase fusion protein CSB-PGBD3 to chromosomal AP-1 proteins regulates expression of nearby genes in humans.
23027969 2012 Aberrant expression of c-Jun in glioblastoma by internal ribosome entry site (IRES)-mediated translational activation.
23027619 2012 Transcriptional regulation of the interleukin-11 gene by oncogenic Ras.
22988241 2012 The regulatory mechanism of the LY6K gene expression in human breast cancer cells.
22981541 2012 Transcriptional regulation of human novel gene SPATA12 promoter by AP-1 and HSF.
22974165 2012 Expression of c-Jun, p73, Casp9, and N-ras in thymic epithelial tumors: relationship with the current WHO classification systems.
22966201 2012 Phosphorylation of the eukaryotic translation initiation factor 4E-transporter (4E-T) by c-Jun N-terminal kinase promotes stress-dependent P-body assembly.
22933572 2012 Nucleolar AATF regulates c-Jun-mediated apoptosis.
22926518 2013 Specific interactions between Smad proteins and AP-1 components determine TGF?-induced breast cancer cell invasion.
22911824 2012 Fra-1/AP-1 transcription factor negatively regulates pulmonary fibrosis in vivo.
22879913 2012 AP-1 mediated transcriptional repression of matrix metalloproteinase-9 by recruitment of histone deacetylase 1 in response to interferon ?.
22869147 2013 Erg and AP-1 as determinants of glucocorticoid response in acute lymphoblastic leukemia.
22860098 2012 Transcriptional regulation of PES1 expression by c-Jun in colon cancer.
22853846 2012 Toll-like receptor-9 agonists increase cyclin D1 expression partly through activation of activator protein-1 in human oral squamous cell carcinoma cells.
22843696 2012 Opposite orientations of a transcription factor heterodimer bind DNA cooperatively with interaction partners but have different effects on interferon-? gene transcription.
22801218 2012 Pdcd4 knockdown up-regulates MAP4K1 expression and activation of AP-1 dependent transcription through c-Myc.
22797068 2013 MicroRNA miR-125b controls melanoma progression by direct regulation of c-Jun protein expression.
22791811 2012 Interplay between AP-1 and estrogen receptor ? in regulating gene expression and proliferation networks in breast cancer cells.
22771387 2012 TGF-?1 induces tissue factor expression in human lung fibroblasts in a PI3K/JNK/Akt-dependent and AP-1-dependent manner.
22749179 2012 Cultivated ginseng suppresses ultraviolet B-induced collagenase activation via mitogen-activated protein kinases and nuclear factor ?B/activator protein-1-dependent signaling in human dermal fibroblasts.
22688014 2012 Up-regulation of IL-23 p19 expression in human periodontal ligament fibroblasts by IL-1? via concurrent activation of the NF-?B and MAPKs/AP-1 pathways.
22685373 2012 NF?B and AP-1 drive human myometrial IL8 expression.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22675553 2012 Hepatocyte growth factor increases osteopontin expression in human osteoblasts through PI3K, Akt, c-Src, and AP-1 signaling pathway.
22597534 2012 Dihydrotestosterone inhibits lectin-like oxidized-LDL receptor-1 expression in aortic endothelial cells via a NF-?B/AP-1-mediated mechanism.
22570239 2012 Polycystin-1 regulates amphiregulin expression through CREB and AP1 signalling: implications in ADPKD cell proliferation.
22512945 2012 Chitooligosaccharide elicits acute inflammatory cytokine response through AP-1 pathway in human intestinal epithelial-like (Caco-2) cells.
22508041 2012 MiR-155 negatively regulates c-Jun expression at the post-transcriptional level in human dermal fibroblasts in vitro: implications in UVA irradiation-induced photoaging.
22484283 2012 Macrophage inhibitory cytokine-1 stimulates proliferation of human umbilical vein endothelial cells by up-regulating cyclins D1 and E through the PI3K/Akt-, ERK-, and JNK-dependent AP-1 and E2F activation signaling pathways.
22438909 2012 Blimp1 activation by AP-1 in human lung cancer cells promotes a migratory phenotype and is inhibited by the lysyl oxidase propeptide.
22429882 2012 Intracellular redox equilibrium is essential for the constitutive expression of AP-1 dependent genes in resting cells: studies on TGF-?1 regulation.
22417306 2012 An ErbB receptor-mediated AP-1 regulatory network is modulated by STAT3 and c-MYC during calcium-dependent keratinocyte differentiation.
22399296 2012 p38? mitogen-activated protein kinase (MAPK) confers breast cancer hormone sensitivity by switching estrogen receptor (ER) signaling from classical to nonclassical pathway via stimulating ER phosphorylation and c-Jun transcription.
22394497 2012 Expression of podoplanin in human astrocytic brain tumors is controlled by the PI3K-AKT-AP-1 signaling pathway and promoter methylation.
22384232 2012 Spleen tyrosine kinase regulates AP-1 dependent transcriptional response to minimally oxidized LDL.
22384197 2012 JunD/AP-1-mediated gene expression promotes lymphocyte growth dependent on interleukin-7 signal transduction.
22354960 2012 c-Jun and Ets2 proteins regulate expression of spleen tyrosine kinase in T cells.
22331067 2012 I?B kinase ? is required for activation of NF-?B and AP-1 in CD3/CD28-stimulated primary CD4(+) T cells.
22328508 2012 AP1 is essential for generation of autophagosomes from the trans-Golgi network.
22307329 2012 DYRK2 priming phosphorylation of c-Jun and c-Myc modulates cell cycle progression in human cancer cells.
22271878 2012 Constitutive AP-1 activity and EBV infection induce PD-L1 in Hodgkin lymphomas and posttransplant lymphoproliferative disorders: implications for targeted therapy.
22271085 2012 The functional role of Notch signaling in HPV-mediated transformation is dose-dependent and linked to AP-1 alterations.
22266871 2012 Inhibition of Gli1 results in altered c-Jun activation, inhibition of cisplatin-induced upregulation of ERCC1, XPD and XRCC1, and inhibition of platinum-DNA adduct repair.
22265050 2012 Targeted deletion of Jun/AP-1 in alveolar epithelial cells causes progressive emphysema and worsens cigarette smoke-induced lung inflammation.
22239235 2012 Double-stranded RNA-induced activation of activating protein-1 promoter is differentially regulated by the non-structural protein 1 of avian influenza A viruses.
22235337 2012 AP-1 transcription factors, mucin-type molecules and MMPs regulate the IL-11 mediated invasiveness of JEG-3 and HTR-8/SVneo trophoblastic cells.
22189957 2012 Functional genetic variants of c-Jun and their interaction with smoking and drinking increase the susceptibility to lung cancer in southern and eastern Chinese.
22176144 2011 c-Jun expression in human neuropathies: a pilot study.
22139817 2012 Inhibition of activator protein 1 signaling abrogates transforming growth factor ?-mediated activation of fibroblasts and prevents experimental fibrosis.
22132731 2011 Activator protein 1 (AP-1) contributes to EpCAM-dependent breast cancer invasion.
22119392 2012 BMP-2 inhibits TF expression in human monocytes by shutting down MAPK signaling and AP-1 transcriptional activity.
22092038 2012 Activator protein-1 (AP-1) signalling in human atherosclerosis: results of a systematic evaluation and intervention study.
22083952 2012 The forkhead transcription factor FOXK2 promotes AP-1-mediated transcriptional regulation.
22051934 2011 Icariside II enhances Nrf2 nuclear translocation to upregulate phase II detoxifying enzyme expression coupled with the ERK, Akt and JNK signaling pathways.
22002117 2011 Activator protein-1 involvement in proliferation inhibition by gene silencing of Twist in gastric cancer cells.
22001392 2011 AP-1 elements and TCL1 protein regulate expression of the gene encoding protein tyrosine phosphatase PTPROt in leukemia.
21989944 2011 Low molecular weight hyaluronan, via AP-1 and NF-?B signalling, induces IL-8 in transformed bronchial epithelial cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21972703 2010 [Prognostic value of the molecular markers ICAM-1 and C-JUN in patients with lung cancer].
21937452 2011 Binding site specificity and factor redundancy in activator protein-1-driven human papillomavirus chromatin-dependent transcription.
21895606 2012 AP-1 and NF-?B transcriptionally regulate interleukin-8 in EA.Hy926 cells under shear stress.
21872498 2013 c-Jun is involved in interstitial cystitis antiproliferative factor (APF)-induced growth inhibition of human bladder cancer T24 cells.
21862593 2011 Auto-activation of c-JUN gene by amino acid deprivation of hepatocellular carcinoma cells reveals a novel c-JUN-mediated signaling pathway.
21835891 2011 Estrogen induces c-myc gene expression via an upstream enhancer activated by the estrogen receptor and the AP-1 transcription factor.
21835421 2011 TAK1 regulates NF-?B and AP-1 activation in airway epithelial cells following RSV infection.
21822357 2011 HPV16E6-dependent c-fos expression contributes to AP-1 complex formation in SiHa cells.
21814482 2011 Dimerumic acid inhibits SW620 cell invasion by attenuating H?O?-mediated MMP-7 expression via JNK/C-Jun and ERK/C-Fos activation in an AP-1-dependent manner.
21801875 2011 Podoplanin is regulated by AP-1 and promotes platelet aggregation and cell migration in osteosarcoma.
21799768 2011 Enhanced chromatin accessibility and recruitment of JUNB mediate the sustained IL-4 expression in NFAT1 deficient T helper 2 cells.
21745629 2011 Capsaicin attenuates palmitate-induced expression of macrophage inflammatory protein 1 and interleukin 8 by increasing palmitate oxidation and reducing c-Jun activation in THP-1 (human acute monocytic leukemia cell) cells.
21743958 2011 Inhibition of Egr-1 by siRNA in prostate carcinoma cell lines is associated with decreased expression of AP-1 and NF-?B.
21739277 2011 The non-steroidal anti-inflammatory drugs Sulindac sulfide and Diclofenac induce apoptosis and differentiation in human acute myeloid leukemia cells through an AP-1 dependent pathway.
21732343 2012 ETS-1/RhoC signaling regulates the transcription factor c-Jun in melanoma.
21703547 2011 c-Jun binding site identification in K562 cells.
21699750 2011 Human HS1BP3 induces cell apoptosis and activates AP-1.
21697091 2011 Truncation, randomization, and selection: generation of a reduced length c-Jun antagonist that retains high interaction stability.
21685329 2011 Experimental hypertension triggers varicosis-like maladaptive venous remodeling through activator protein-1.
21647439 2011 AP-1 is a component of the transcriptional network regulated by GSK-3 in quiescent cells.
21640141 2011 Phosphorylated c-Jun and Fra-1 induce matrix metalloproteinase-1 and thereby regulate invasion activity of 143B osteosarcoma cells.
21617851 2011 Overexpression of EGR-1 modulates the activity of NF-?B and AP-1 in prostate carcinoma PC-3 and LNCaP cell lines.
21617575 2011 Peroxisome proliferator-activated receptor ? agonist troglitazone inhibits high mobility group box 1 expression in endothelial cells via suppressing transcriptional activity of nuclear factor ?B and activator protein 1.
21570970 2011 c-Jun/AP-1 transcription factor regulates laminin-1-induced neurite outgrowth in human bone marrow mesenchymal stem cells: role of multiple signaling pathways.
21559334 2011 CDK-mediated regulation of cell functions via c-Jun phosphorylation and AP-1 activation.
21530485 2011 AP-1 binding transcriptionally regulates human neutral ceramidase.
21526160 2011 The AP-1 binding sites located in the pol gene intragenic regulatory region of HIV-1 are important for viral replication.
21518489 2011 [Mechanisms of preventive effect of tetrandrine on acquired multidrug resistance in K562 cells].
21511059 2011 Protective effect of kobophenol A on nitric oxide-induced cell apoptosis in human osteoblast-like MG-63 cells: involvement of JNK, NF-?B and AP-1 pathways.
21496208 2011 Energetic coupling along an allosteric communication channel drives the binding of Jun-Fos heterodimeric transcription factor to DNA.
21454713 2011 Opposite regulation of the human apolipoprotein M gene by hepatocyte nuclear factor 1 and Jun transcription factors.
21451046 2011 Diffuse traumatic axonal injury in the mouse induces atrophy, c-Jun activation, and axonal outgrowth in the axotomized neuronal population.
21439937 2011 c-Jun localizes to the nucleus independent of its phosphorylation by and interaction with JNK and vice versa promotes nuclear accumulation of JNK.
21417953 2011 Inhibition of AP-1 suppresses cervical cancer cell proliferation and is associated with p21 expression.
21410405 2011 STAT3 controls matrix metalloproteinase-1 expression in colon carcinoma cells by both direct and AP-1-mediated interaction with the MMP-1 promoter.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21397653 2011 Protective effects of Chlorella-derived peptide on UVB-induced production of MMP-1 and degradation of procollagen genes in human skin fibroblasts.
21393476 2011 Functional variants of -1318T > G and -673C > T in c-Jun promoter region associated with increased colorectal cancer risk by elevating promoter activity.
21381700 2011 Presence of divalent cation is not mandatory for the formation of intramolecular purine-motif triplex containing human c-jun protooncogene target.
21364631 2010 Role of the JNK/c-Jun/AP-1 signaling pathway in galectin-1-induced T-cell death.
21360282 2011 DUSP13B/TMDP inhibits stress-activated MAPKs and suppresses AP-1-dependent gene expression.
21350237 Functional cooperation between GATA factors and cJUN on the star promoter in MA-10 Leydig cells.
21349840 2011 Liver X receptor-retinoid X receptor (LXR-RXR) heterodimer cistrome reveals coordination of LXR and AP1 signaling in keratinocytes.
21338584 2011 Prodynorphin promoter SNP associated with alcohol dependence forms noncanonical AP-1 binding site that may influence gene expression in human brain.
21289643 2011 c-Jun promotes whereas JunB inhibits epidermal neoplasia.
21268080 2011 Cigarette smoke extract regulates cytosolic phospholipase A2 expression via NADPH oxidase/MAPKs/AP-1 and p300 in human tracheal smooth muscle cells.
21212516 2011 Silibinin activated p53 and induced autophagic death in human fibrosarcoma HT1080 cells via reactive oxygen species-p38 and c-Jun N-terminal kinase pathways.
21199371 2011 Thermodynamic analysis of Jun-Fos coiled coil peptide antagonists.
21177766 2011 P21-activated protein kinase (PAK2)-mediated c-Jun phosphorylation at 5 threonine sites promotes cell transformation.
21148792 2011 Essential role of NF-?B and AP-1 transcription factors in TNF-?-induced TSLP expression in human airway smooth muscle cells.
21145111 2011 IL-17R activation of human periodontal ligament fibroblasts induces IL-23 p19 production: Differential involvement of NF-?B versus JNK/AP-1 pathways.
21134350 2011 Androgen receptor-mediated regulation of the anti-atherogenic enzyme CYP27A1 involves the JNK/c-jun pathway.
21113145 2011 Parkin is transcriptionally regulated by ATF4: evidence for an interconnection between mitochondrial stress and ER stress.
21106746 2011 The activator protein 1 binding motifs within the human cytomegalovirus major immediate-early enhancer are functionally redundant and act in a cooperative manner with the NF-{kappa}B sites during acute infection.
21106530 2011 Alcohol induces RNA polymerase III-dependent transcription through c-Jun by co-regulating TATA-binding protein (TBP) and Brf1 expression.
21081472 2011 MSP-induced RON activation upregulates uPAR expression and cell invasiveness via MAPK, AP-1 and NF-?B signals in gastric cancer cells.
21081043 2010 [Expression and significance of COX-2 and its transcription factors NFAT3 and c-Jun in non-small cell lung cancer].
21034562 2010 Intracellular CMTM2 negatively regulates human immunodeficiency virus type-1 transcription through targeting the transcription factors AP-1 and CREB.
21030269 2011 Transcription factor Ap-1 mediates proangiogenic MIF expression in human endothelial cells exposed to Angiotensin II.
20977688 2011 Post-transcriptional regulation controlled by E-cadherin is important for c-Jun activity in melanoma.
20976196 2010 Leishmania-induced inactivation of the macrophage transcription factor AP-1 is mediated by the parasite metalloprotease GP63.
20955203 2011 TNF receptor I on human keratinocytes is a binding partner for staphylococcal protein A resulting in the activation of NF kappa B, AP-1, and downstream gene transcription.
20952681 2010 Endothelin-1-induced macrophage inflammatory protein-1beta expression in monocytic cells involves hypoxia-inducible factor-1alpha and AP-1 and is negatively regulated by microRNA-195.
20943203 2011 Estrogen regulation of human with-no-lysine (K) kinase-4 gene expression involves AP-1 transcription factor.
20942798 2011 PMA-induced up-regulation of TBX3 is mediated by AP-1 and contributes to breast cancer cell migration.
20939893 2010 Catecholamine up-regulates MMP-7 expression by activating AP-1 and STAT3 in gastric cancer.
20936779 2010 A human MAP kinase interactome.
20852630 2010 Identification of a co-activator that links growth factor signalling to c-Jun/AP-1 activation.
20837772 2010 Fra-2/AP-1 controls bone formation by regulating osteoblast differentiation and collagen production.
20698984 2010 The clinical Pseudomonas fluorescens MFN1032 strain exerts a cytotoxic effect on epithelial intestinal cells and induces Interleukin-8 via the AP-1 signaling pathway.
20688351 2010 Activation of the transcription factor c-Jun in acute cellular and antibody-mediated rejection after kidney transplantation.
20683948 2010 c-Jun mediates hepatitis C virus hepatocarcinogenesis through signal transducer and activator of transcription 3 and nitric oxide-dependent impairment of oxidative DNA repair.
20680410 2010 The role of neurofibromin in N-Ras mediated AP-1 regulation in malignant peripheral nerve sheath tumors.
20665665 2010 Oxidative stress enhances AP-1 and NF-?B-mediated regulation of ?(2)-glycoprotein I gene expression in hepatoma cells.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20619956 2010 Unfolding of bZIP dimers formed by the ATF-2 and c-Jun transcription factors is not a simple two-state transition.
20607803 2010 Transcriptional activity of TAp63 promoter is regulated by c-jun.
20590529 2010 Dual roles for MEF2A and MEF2D during human macrophage terminal differentiation and c-Jun expression.
20557936 2010 The C-terminal region of human NFATc2 binds cJun to synergistically activate interleukin-2 transcription.
20554528 2010 Differential up-regulation of MAP kinase phosphatases MKP3/DUSP6 and DUSP5 by Ets2 and c-Jun converge in the control of the growth arrest versus proliferation response of MCF-7 breast cancer cells to phorbol ester.
20543003 2010 AP-1 overexpression impairs corticosteroid inhibition of collagen production by fibroblasts isolated from asthmatic subjects.
20531301 2010 Inhibition of AP-1 by SARI negatively regulates transformation progression mediated by CCN1.
20519498 2010 Transcription of the transforming growth factor beta activating integrin beta8 subunit is regulated by SP3, AP-1, and the p38 pathway.
20511396 2010 In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo.
20510020 2010 SAMD4B, a novel SAM-containing protein, inhibits AP-1-, p53- and p21-mediated transcriptional activity.
20508969 2010 Involvement of aryl hydrocarbon receptor nuclear translocator in EGF-induced c-Jun/Sp1-mediated gene expression.
20507572 2010 Differential cytokine regulation by NF-kappaB and AP-1 in Jurkat T-cells.
20505831 2010 The leucine zipper domains of the transcription factors GCN4 and c-Jun have ribonuclease activity.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20483790 2010 Mycobacterium tuberculosis upregulates microglial matrix metalloproteinase-1 and -3 expression and secretion via NF-kappaB- and Activator Protein-1-dependent monocyte networks.
20482821 2010 BEX2 has a functional interplay with c-Jun/JNK and p65/RelA in breast cancer.
20479762 2011 Maternal warmth buffers the effects of low early-life socioeconomic status on pro-inflammatory signaling in adulthood.
20459032 2010 [Effects of acrylamide on the protein expressions of c-fos and c-jun proto-oncogenes in cell L-02].
20448330 2010 NFAT and AP1 are essential for the expression of a glioblastoma multiforme related IL-13Ra2 transcript.
20432452 2010 Interleukin-1beta induces ICAM-1 expression enhancing leukocyte adhesion in human rheumatoid arthritis synovial fibroblasts: involvement of ERK, JNK, AP-1, and NF-kappaB.
20430872 2010 CHOP and AP-1 cooperatively mediate PUMA expression during lipoapoptosis.
20395206 2010 Extracellular signal-regulated kinase 8-mediated c-Jun phosphorylation increases tumorigenesis of human colon cancer.
20371606 2010 Activation of AP-1 transcription factors differentiates FGF2 and vascular endothelial growth factor regulation of endothelial nitric-oxide synthase expression in placental artery endothelial cells.
20353996 2010 TAF4b and Jun/activating protein-1 collaborate to regulate the expression of integrin alpha6 and cancer cell migration properties.
20353950 2010 AP-1 (Fra-1/c-Jun)-mediated induction of expression of matrix metalloproteinase-2 is required for 15S-hydroxyeicosatetraenoic acid-induced angiogenesis.
20333648 2010 EV71 induces COX-2 expression via c-Src/PDGFR/PI3K/Akt/p42/p44 MAPK/AP-1 and NF-kappaB in rat brain astrocytes.
20331980 2010 Human TMEM174 that is highly expressed in kidney tissue activates AP-1 and promotes cell proliferation.
20331972 2010 Dissecting the role of leucine zippers in the binding of bZIP domains of Jun transcription factor to DNA.
20331627 2010 ZAK inhibits human lung cancer cell growth via ERK and JNK activation in an AP-1-dependent manner.
20306472 2010 SARM inhibits both TRIF- and MyD88-mediated AP-1 activation.
20227498 2010 Expression of MAP3 kinase COT1 is up-regulated by 1,25-dihydroxyvitamin D3 in parallel with activated c-jun during differentiation of human myeloid leukemia cells.
20225236 2010 IL-6 and high glucose synergistically upregulate MMP-1 expression by U937 mononuclear phagocytes via ERK1/2 and JNK pathways and c-Jun.
20222112 2010 Regulation of CCN2/connective tissue growth factor expression in the nucleus pulposus of the intervertebral disc: role of Smad and activator protein 1 signaling.
20203690 2010 Activation of GPR30 inhibits the growth of prostate cancer cells through sustained activation of Erk1/2, c-jun/c-fos-dependent upregulation of p21, and induction of G(2) cell-cycle arrest.
20198339 2010 Bile acid regulates MUC2 transcription in colon cancer cells via positive EGFR/PKC/Ras/ERK/CREB, PI3K/Akt/IkappaB/NF-kappaB and p38/MSK1/CREB pathways and negative JNK/c-Jun/AP-1 pathway.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20193273 2009 [Effect of ERK/AP-1 signaling pathway on proliferation of hepatoma cells induced by PAR-2 agonists].
20185758 2010 The antiapoptotic DeltaNp73 is degraded in a c-Jun-dependent manner upon genotoxic stress through the antizyme-mediated pathway.
20170659 2010 X-box binding protein 1 regulates brain natriuretic peptide through a novel AP1/CRE-like element in cardiomyocytes.
20137127 2010 [Role of bone marrow microenvironment in regulation of AP-1 gene expression in multiple myeloma cells].
20133937 2010 Inhibiting TRAF2-mediated activation of NF-kappaB facilitates induction of AP-1.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
20093361 2010 Expression of a homeostatic regulator, Wip1 (wild-type p53-induced phosphatase), is temporally induced by c-Jun and p53 in response to UV irradiation.
20074357 2010 Differential requirement of the epidermal growth factor receptor for G protein-mediated activation of transcription factors by lysophosphatidic acid.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20053993 2010 c-Jun induces mammary epithelial cellular invasion and breast cancer stem cell expansion.
20051654 2010 Possible involvements of nuclear factor-kappa B and activator protein-1 in the tumor necrosis factor-alpha-induced upregulation of matrix metalloproteinase-12 in human alveolar epithelial A549 cell line.
20044606 2009 Infrequent amplification of JUN in hepatocellular carcinoma.
19965873 2010 A novel subtype of AP-1-binding motif within the palmitoylated trans-Golgi network/endosomal accessory protein Gadkin/gamma-BAR.
19962668 2009 miR-221&222 regulate TRAIL resistance and enhance tumorigenicity through PTEN and TIMP3 downregulation.
19959471 2010 Mitogenic regulation of p27(Kip1) gene is mediated by AP-1 transcription factors.
19944700 2010 Stability and DNA-binding ability of the bZIP dimers formed by the ATF-2 and c-Jun transcription factors.
19939924 2010 Tpl2/AP-1 enhances murine gammaherpesvirus 68 lytic replication.
19937979 2010 Up-regulation of TRPM6 transcriptional activity by AP-1 in renal epithelial cells.
19937141 2009 Activation of JNK and c-Jun is involved in glucose oxidase-mediated cell death of human lymphoma cells.
19921846 2009 DNA plasticity is a key determinant of the energetics of binding of Jun-Fos heterodimeric transcription factor to genetic variants of TGACGTCA motif.
19919900 Activator protein-1 in carotid plaques is related to cerebrovascular symptoms and cholesteryl ester content.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910471 2010 c-Jun regulates phosphoinositide-dependent kinase 1 transcription: implication for Akt and protein kinase C activities and melanoma tumorigenesis.
19898747 2010 Enteroaggregative Escherichia coli infection induces IL-8 production via activation of mitogen-activated protein kinases and the transcription factors NF-kappaB and AP-1 in INT-407 cells.
19885545 2009 Activation of two distinct MAPK pathways governs constitutive expression of matrix metalloproteinase-1 in human pancreatic cancer cell lines.
19878434 2010 AP-1 inhibitory peptides are neuroprotective following acute glutamate excitotoxicity in primary cortical neuronal cultures.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19861239 2010 cJun modulates Ggamma-globin gene expression via an upstream cAMP response element.
19860880 2009 LMP1-augmented kappa intron enhancer activity contributes to upregulation expression of Ig kappa light chain via NF-kappaB and AP-1 pathways in nasopharyngeal carcinoma cells.
19859790 2010 c-Jun-NH2 terminal kinase (JNK)-mediates AP-1 activation by thioredoxin: phosphorylation of cJun, JunB, and Fra-1.
19841138 2009 AP-1 and KIF13A coordinate endosomal sorting and positioning during melanosome biogenesis.
19837979 2010 Identification of early growth response protein 1 (EGR-1) as a novel target for JUN-induced apoptosis in multiple myeloma.
19811296 2009 Activator protein 1 shows a biphasic induction and transcriptional activity after low dose X-irradiation in EA.hy.926 endothelial cells.
19806201 2009 Basal cancer cell survival involves JNK2 suppression of a novel JNK1/c-Jun/Bcl-3 apoptotic network.
19795388 2009 Quantitative AP-1 gene regulation by oxidative stress in the human retinal pigment epithelium.
19794957 2009 Hypoxia-induced decrease in p53 protein level and increase in c-jun DNA binding activity results in cancer cell resistance to etoposide.
19787273 2009 Transcription factor AP-1 promotes growth and radioresistance in prostate cancer cells.
19782465 2010 Lithocholic acid upregulates uPAR and cell invasiveness via MAPK and AP-1 signaling in colon cancer cells.
19758438 2009 Transcription factor AP-1 in esophageal squamous cell carcinoma: alterations in activity and expression during human Papillomavirus infection.
19758340 2010 The potential role of c-Jun activation in patients with cutaneous lichen planus.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19734233 2009 c-jun controls the ability of IL-12 to induce IL-10 production from human memory CD4+ T cells.
19723051 2009 Activator protein-1 mediates docosahexaenoic acid-induced apoptosis of human gastric cancer cells.
19714312 2009 Identification of GATA2 and AP-1 Activator elements within the enhancer VNTR occurring in intron 5 of the human SIRT3 gene.
19701800 2010 LNX (Ligand of Numb-protein X) interacts with RhoC, both of which regulate AP-1-mediated transcriptional activation.